Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7P1N5

Protein Details
Accession A0A1B7P1N5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
130-149LPEYVRKMKEWRQRKERAKLBasic
NLS Segment(s)
PositionSequence
138-148KEWRQRKERAK
Subcellular Location(s) cysk 20, cyto 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039298  ACOT13  
IPR029069  HotDog_dom_sf  
IPR006683  Thioestr_dom  
Gene Ontology GO:0047617  F:acyl-CoA hydrolase activity  
Pfam View protein in Pfam  
PF03061  4HBT  
CDD cd03443  PaaI_thioesterase  
Amino Acid Sequences GYDRQLMQDLRLIDAFPTGGAIWELPITEFWANLNGVMHGGGYGVIFDMCTAISMCPISRDGYWEFLAGVTRSLNISYLKAVPIGVTVYIRTNVIQHGRTMALISATMESPDGKVVYATAEHHKVHTPALPEYVRKMKEWRQRKERAKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.09
4 0.1
5 0.07
6 0.07
7 0.07
8 0.07
9 0.07
10 0.07
11 0.07
12 0.06
13 0.07
14 0.09
15 0.09
16 0.09
17 0.09
18 0.11
19 0.11
20 0.11
21 0.12
22 0.08
23 0.09
24 0.09
25 0.08
26 0.05
27 0.05
28 0.04
29 0.04
30 0.04
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.04
38 0.04
39 0.04
40 0.05
41 0.06
42 0.06
43 0.07
44 0.08
45 0.09
46 0.08
47 0.12
48 0.12
49 0.15
50 0.16
51 0.14
52 0.13
53 0.12
54 0.13
55 0.1
56 0.09
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.08
65 0.08
66 0.08
67 0.08
68 0.08
69 0.07
70 0.07
71 0.07
72 0.06
73 0.05
74 0.06
75 0.07
76 0.07
77 0.08
78 0.07
79 0.08
80 0.1
81 0.14
82 0.14
83 0.13
84 0.15
85 0.15
86 0.15
87 0.14
88 0.12
89 0.08
90 0.08
91 0.08
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.07
98 0.08
99 0.08
100 0.07
101 0.07
102 0.07
103 0.07
104 0.09
105 0.11
106 0.15
107 0.2
108 0.2
109 0.22
110 0.25
111 0.25
112 0.26
113 0.27
114 0.25
115 0.22
116 0.28
117 0.29
118 0.28
119 0.33
120 0.4
121 0.38
122 0.37
123 0.43
124 0.46
125 0.53
126 0.62
127 0.66
128 0.68
129 0.78