Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7P1X7

Protein Details
Accession A0A1B7P1X7    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
61-89AEYEYKPLLQKRKRTRKRDKNPEFALKAGHydrophilic
NLS Segment(s)
PositionSequence
71-99KRKRTRKRDKNPEFALKAGRPTKEKKKGE
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR023780  Chromo_domain  
IPR044251  LHP1-like  
Gene Ontology GO:0031507  P:heterochromatin formation  
Pfam View protein in Pfam  
PF00385  Chromo  
PROSITE View protein in PROSITE  
PS50013  CHROMO_2  
CDD cd00024  CD_CSD  
Amino Acid Sequences MARFQTRNPQSVDGNNKFEVERIPNKRTHYGKIQYLVKRKVFIETENSWEPEAHLTDSHNAEYEYKPLLQKRKRTRKRDKNPEFALKAGRPTKEKKKGETAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.47
3 0.44
4 0.4
5 0.37
6 0.33
7 0.3
8 0.33
9 0.36
10 0.39
11 0.43
12 0.48
13 0.55
14 0.55
15 0.53
16 0.53
17 0.52
18 0.52
19 0.55
20 0.58
21 0.56
22 0.61
23 0.63
24 0.56
25 0.52
26 0.47
27 0.45
28 0.38
29 0.33
30 0.31
31 0.26
32 0.29
33 0.28
34 0.29
35 0.24
36 0.23
37 0.21
38 0.16
39 0.15
40 0.1
41 0.09
42 0.09
43 0.11
44 0.13
45 0.12
46 0.11
47 0.11
48 0.12
49 0.12
50 0.13
51 0.12
52 0.13
53 0.16
54 0.2
55 0.3
56 0.35
57 0.44
58 0.54
59 0.64
60 0.72
61 0.8
62 0.87
63 0.89
64 0.93
65 0.95
66 0.94
67 0.93
68 0.91
69 0.9
70 0.81
71 0.73
72 0.69
73 0.6
74 0.59
75 0.53
76 0.5
77 0.45
78 0.51
79 0.6
80 0.63
81 0.67
82 0.66