Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2JR17

Protein Details
Accession I2JR17    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
105-130AGNMVWRNKKDKKQQRCDEYNYKRGHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11, cyto 8.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022024  DUF3602  
Pfam View protein in Pfam  
PF12223  DUF3602  
Amino Acid Sequences MPSLDPVFSVGRGGAGNMMNANTAQKAENEVVLQEEGIRKGKNKSGSFKADKEGNYTVSAGRGGAGNIYKVKEDPLTTRNREDAQNQDHEMEDLRPVYSVGRGGAGNMVWRNKKDKKQQRCDEYNYKRGHRSQHFSSSFGCVWEELCGKLAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.12
4 0.12
5 0.12
6 0.11
7 0.11
8 0.12
9 0.09
10 0.1
11 0.1
12 0.09
13 0.13
14 0.13
15 0.15
16 0.14
17 0.13
18 0.14
19 0.13
20 0.12
21 0.1
22 0.11
23 0.12
24 0.15
25 0.16
26 0.17
27 0.21
28 0.26
29 0.34
30 0.37
31 0.41
32 0.46
33 0.54
34 0.57
35 0.55
36 0.55
37 0.5
38 0.46
39 0.44
40 0.38
41 0.31
42 0.26
43 0.25
44 0.2
45 0.16
46 0.16
47 0.1
48 0.08
49 0.07
50 0.06
51 0.07
52 0.07
53 0.07
54 0.09
55 0.09
56 0.09
57 0.09
58 0.1
59 0.1
60 0.11
61 0.13
62 0.17
63 0.24
64 0.26
65 0.27
66 0.28
67 0.29
68 0.3
69 0.29
70 0.31
71 0.28
72 0.29
73 0.29
74 0.27
75 0.25
76 0.23
77 0.22
78 0.15
79 0.12
80 0.09
81 0.08
82 0.08
83 0.08
84 0.08
85 0.08
86 0.08
87 0.07
88 0.08
89 0.08
90 0.08
91 0.09
92 0.09
93 0.11
94 0.13
95 0.18
96 0.19
97 0.21
98 0.29
99 0.36
100 0.45
101 0.53
102 0.61
103 0.67
104 0.76
105 0.84
106 0.86
107 0.86
108 0.86
109 0.86
110 0.84
111 0.82
112 0.78
113 0.73
114 0.7
115 0.67
116 0.68
117 0.66
118 0.65
119 0.64
120 0.67
121 0.64
122 0.59
123 0.56
124 0.52
125 0.44
126 0.37
127 0.31
128 0.2
129 0.18
130 0.21
131 0.21
132 0.15