Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NKF2

Protein Details
Accession A0A1B7NKF2   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
21-43GGDRGRGRGRRGRRGPKSDEKEWBasic
NLS Segment(s)
PositionSequence
10-38ARGGFGSRGDRGGDRGRGRGRRGRRGPKS
Subcellular Location(s) cyto 12, nucl 7, cyto_mito 7, cyto_pero 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000851  Ribosomal_S5  
IPR013810  Ribosomal_S5_N  
IPR018192  Ribosomal_S5_N_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00333  Ribosomal_S5  
PROSITE View protein in PROSITE  
PS00585  RIBOSOMAL_S5  
PS50881  S5_DSRBD  
Amino Acid Sequences MADAPRGGAARGGFGSRGDRGGDRGRGRGRRGRRGPKSDEKEWQPVTKLGRLVKAGKITSMEQIYLHSLPIKEYQIVDFFLKLKDEVMKIKPVQKQTRAGQRTRFKAIVVIGDSEGHVGLGIKTSKEVATAIRAAIIIAKLSVLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.16
4 0.18
5 0.17
6 0.17
7 0.2
8 0.26
9 0.33
10 0.32
11 0.38
12 0.45
13 0.5
14 0.55
15 0.59
16 0.62
17 0.65
18 0.73
19 0.76
20 0.78
21 0.8
22 0.83
23 0.85
24 0.84
25 0.78
26 0.76
27 0.71
28 0.69
29 0.64
30 0.58
31 0.49
32 0.45
33 0.43
34 0.38
35 0.37
36 0.3
37 0.31
38 0.31
39 0.31
40 0.31
41 0.32
42 0.28
43 0.25
44 0.25
45 0.22
46 0.23
47 0.21
48 0.17
49 0.13
50 0.13
51 0.15
52 0.13
53 0.12
54 0.1
55 0.1
56 0.1
57 0.13
58 0.13
59 0.11
60 0.11
61 0.12
62 0.11
63 0.13
64 0.12
65 0.1
66 0.1
67 0.1
68 0.1
69 0.09
70 0.09
71 0.1
72 0.11
73 0.14
74 0.16
75 0.21
76 0.23
77 0.29
78 0.33
79 0.4
80 0.46
81 0.47
82 0.53
83 0.54
84 0.63
85 0.62
86 0.62
87 0.63
88 0.64
89 0.63
90 0.62
91 0.56
92 0.46
93 0.43
94 0.4
95 0.35
96 0.28
97 0.24
98 0.19
99 0.18
100 0.18
101 0.15
102 0.13
103 0.08
104 0.07
105 0.05
106 0.05
107 0.09
108 0.1
109 0.1
110 0.11
111 0.12
112 0.12
113 0.13
114 0.14
115 0.11
116 0.15
117 0.16
118 0.16
119 0.16
120 0.15
121 0.14
122 0.16
123 0.14
124 0.1
125 0.09