Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7P500

Protein Details
Accession A0A1B7P500   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-31IPTSQDPRSKRPLKRRALTPVSEHydrophilic
118-153EEARRRDEEKTEKNRRKREKKKKAKEKKASAGPSDTBasic
NLS Segment(s)
PositionSequence
115-146RRREEARRRDEEKTEKNRRKREKKKKAKEKKA
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSEPIPESIPTSQDPRSKRPLKRRALTPVSEQATQIQSLFKDPSKDIPIPAPPKPRTSASLAPPPEIIANVQGSSAGAGSGEFHVYKASRRREYERLKLMEQELKIDQADELFERRREEARRRDEEKTEKNRRKREKKKKAKEKKASAGPSDTGPNTDEMREPNGKSANERGVTGVRIRYPELRTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.51
4 0.57
5 0.64
6 0.71
7 0.75
8 0.79
9 0.83
10 0.84
11 0.84
12 0.83
13 0.77
14 0.73
15 0.71
16 0.64
17 0.56
18 0.48
19 0.41
20 0.35
21 0.31
22 0.25
23 0.18
24 0.15
25 0.17
26 0.2
27 0.18
28 0.2
29 0.2
30 0.26
31 0.3
32 0.31
33 0.29
34 0.3
35 0.37
36 0.38
37 0.43
38 0.46
39 0.42
40 0.45
41 0.47
42 0.45
43 0.4
44 0.43
45 0.43
46 0.39
47 0.45
48 0.42
49 0.4
50 0.37
51 0.34
52 0.27
53 0.21
54 0.16
55 0.09
56 0.09
57 0.08
58 0.08
59 0.07
60 0.07
61 0.07
62 0.06
63 0.04
64 0.03
65 0.03
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.06
72 0.07
73 0.11
74 0.18
75 0.25
76 0.3
77 0.34
78 0.39
79 0.48
80 0.55
81 0.59
82 0.59
83 0.56
84 0.51
85 0.5
86 0.46
87 0.41
88 0.34
89 0.28
90 0.2
91 0.18
92 0.17
93 0.15
94 0.12
95 0.08
96 0.09
97 0.07
98 0.09
99 0.1
100 0.12
101 0.13
102 0.15
103 0.2
104 0.26
105 0.34
106 0.41
107 0.48
108 0.55
109 0.59
110 0.62
111 0.65
112 0.68
113 0.69
114 0.7
115 0.72
116 0.73
117 0.78
118 0.83
119 0.87
120 0.89
121 0.9
122 0.91
123 0.91
124 0.93
125 0.95
126 0.96
127 0.97
128 0.97
129 0.96
130 0.95
131 0.94
132 0.92
133 0.87
134 0.8
135 0.73
136 0.63
137 0.54
138 0.48
139 0.38
140 0.3
141 0.24
142 0.23
143 0.2
144 0.19
145 0.19
146 0.17
147 0.23
148 0.27
149 0.27
150 0.3
151 0.35
152 0.34
153 0.36
154 0.41
155 0.42
156 0.39
157 0.38
158 0.35
159 0.32
160 0.34
161 0.34
162 0.32
163 0.27
164 0.28
165 0.31
166 0.35