Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JX16

Protein Details
Accession I2JX16    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-64ERNIPESERRKIRKRKIILKHFLGKLBasic
NLS Segment(s)
PositionSequence
49-60ERRKIXRKXRKI
Subcellular Location(s) nucl 17, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013950  Mis14/Nsl1  
Gene Ontology GO:0000776  C:kinetochore  
GO:0000070  P:mitotic sister chromatid segregation  
Pfam View protein in Pfam  
PF08641  Mis14  
Amino Acid Sequences MPEEYXKIHIEAAELKALYSRLKAYLSKVXDEQLSDEXLFKERNIPESERRKIXRKXRKIILKHFLGKLFNSLKYSLAVDDNVMHSIVDPESDIVDELKRMEDTEEKTEPYDFALNDKLRSMYFEVENMFSVVAKLRKNTPGDVYKNTESRLQKNDXXINEIIAKEKXIFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.21
4 0.21
5 0.17
6 0.17
7 0.15
8 0.19
9 0.2
10 0.23
11 0.3
12 0.34
13 0.36
14 0.36
15 0.36
16 0.33
17 0.34
18 0.31
19 0.24
20 0.21
21 0.18
22 0.17
23 0.16
24 0.16
25 0.17
26 0.16
27 0.21
28 0.23
29 0.27
30 0.35
31 0.43
32 0.51
33 0.56
34 0.63
35 0.67
36 0.74
37 0.79
38 0.8
39 0.8
40 0.83
41 0.84
42 0.87
43 0.86
44 0.83
45 0.8
46 0.73
47 0.67
48 0.58
49 0.47
50 0.43
51 0.37
52 0.31
53 0.25
54 0.23
55 0.2
56 0.19
57 0.19
58 0.14
59 0.12
60 0.1
61 0.09
62 0.09
63 0.09
64 0.08
65 0.08
66 0.07
67 0.06
68 0.06
69 0.06
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.04
77 0.05
78 0.05
79 0.05
80 0.06
81 0.06
82 0.06
83 0.07
84 0.11
85 0.14
86 0.19
87 0.2
88 0.2
89 0.21
90 0.21
91 0.2
92 0.18
93 0.17
94 0.12
95 0.13
96 0.19
97 0.2
98 0.2
99 0.21
100 0.2
101 0.17
102 0.2
103 0.19
104 0.16
105 0.15
106 0.17
107 0.17
108 0.17
109 0.18
110 0.15
111 0.13
112 0.1
113 0.1
114 0.12
115 0.14
116 0.15
117 0.17
118 0.22
119 0.28
120 0.31
121 0.34
122 0.38
123 0.43
124 0.47
125 0.5
126 0.52
127 0.52
128 0.52
129 0.5
130 0.5
131 0.47
132 0.48
133 0.48
134 0.46
135 0.45
136 0.45
137 0.51
138 0.45
139 0.44
140 0.4
141 0.36
142 0.34
143 0.33