Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7P678

Protein Details
Accession A0A1B7P678    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
112-143QSTPRTDRPPRDPQNRRKRRPKPSPFTKEVEIHydrophilic
NLS Segment(s)
PositionSequence
50-55KAKVKK
120-183PPRDPQNRRKRRPKPSPFTKEVEIAKRRQEELEKKQRIREAKQRDREAMARAKKPDQFGKRRLG
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MAAKRPRDEGAVPDANVAKKKKGFSVGPANLPDGTYRRKVQKIKVDLIHKAKVKKSYAKVKAEELAKGTAKSSYTQESTLENAGDATHPEPASLELHPDRQAMLDTPAAEQQSTPRTDRPPRDPQNRRKRRPKPSPFTKEVEIAKRRQEELEKKQRIREAKQRDREAMARAKKPDQFGKRRLGRESVVLLDRVKRIVQES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.4
4 0.39
5 0.37
6 0.36
7 0.38
8 0.4
9 0.45
10 0.44
11 0.46
12 0.55
13 0.53
14 0.54
15 0.53
16 0.5
17 0.42
18 0.39
19 0.34
20 0.27
21 0.26
22 0.26
23 0.29
24 0.35
25 0.43
26 0.49
27 0.56
28 0.61
29 0.65
30 0.67
31 0.69
32 0.67
33 0.67
34 0.67
35 0.65
36 0.6
37 0.57
38 0.53
39 0.54
40 0.54
41 0.54
42 0.57
43 0.61
44 0.65
45 0.67
46 0.65
47 0.61
48 0.6
49 0.54
50 0.47
51 0.38
52 0.33
53 0.27
54 0.25
55 0.22
56 0.18
57 0.17
58 0.17
59 0.17
60 0.16
61 0.17
62 0.17
63 0.18
64 0.17
65 0.18
66 0.18
67 0.15
68 0.11
69 0.1
70 0.09
71 0.08
72 0.08
73 0.06
74 0.08
75 0.08
76 0.08
77 0.08
78 0.09
79 0.1
80 0.09
81 0.12
82 0.11
83 0.13
84 0.14
85 0.14
86 0.12
87 0.11
88 0.12
89 0.09
90 0.1
91 0.09
92 0.09
93 0.09
94 0.11
95 0.11
96 0.1
97 0.09
98 0.1
99 0.14
100 0.16
101 0.17
102 0.18
103 0.24
104 0.32
105 0.38
106 0.44
107 0.5
108 0.57
109 0.66
110 0.73
111 0.78
112 0.82
113 0.87
114 0.89
115 0.9
116 0.9
117 0.91
118 0.92
119 0.92
120 0.92
121 0.92
122 0.91
123 0.86
124 0.8
125 0.72
126 0.67
127 0.61
128 0.59
129 0.53
130 0.48
131 0.49
132 0.48
133 0.46
134 0.44
135 0.47
136 0.48
137 0.54
138 0.61
139 0.63
140 0.63
141 0.67
142 0.69
143 0.68
144 0.66
145 0.66
146 0.66
147 0.67
148 0.74
149 0.75
150 0.73
151 0.7
152 0.66
153 0.63
154 0.61
155 0.59
156 0.55
157 0.54
158 0.56
159 0.55
160 0.58
161 0.61
162 0.62
163 0.63
164 0.64
165 0.7
166 0.72
167 0.74
168 0.72
169 0.68
170 0.6
171 0.56
172 0.52
173 0.47
174 0.41
175 0.38
176 0.35
177 0.34
178 0.33
179 0.3
180 0.27