Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7P3Z9

Protein Details
Accession A0A1B7P3Z9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
32-58IQMLLPSRVRRKLRSKLRSRVSPSSTIHydrophilic
NLS Segment(s)
PositionSequence
41-47RRKLRSK
Subcellular Location(s) plas 24, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR026841  Aur1/Ipt1  
IPR036938  P_Acid_Pase_2/haloperoxi_sf  
IPR000326  P_Acid_Pase_2/haloperoxidase  
Gene Ontology GO:0016020  C:membrane  
GO:0006629  P:lipid metabolic process  
Pfam View protein in Pfam  
PF14378  PAP2_3  
CDD cd03386  PAP2_Aur1_like  
Amino Acid Sequences MAGVMNPVIPSWKDNSQNYLGKVQIVIPWRSIQMLLPSRVRRKLRSKLRSRVSPSSTITSLNTSFSPFDTLKTLQAHRWSVYDGQYLVLLFVGIFSLCVIESPGPFAKTLVAFGLITSLLLPITCQFFLPFLPIVAWLIYFYACQFISSDWRPPIWVRVLPALENIFYGANLSNILSAHQNTFLDVLAWVPYGIMHYAAPAICSIIIFIFGPPGMTPIFARTFGFMCITAVTIQFLFPCSPPWYENLYGLAPAHYGIPGSPGGLARIDELFGIDIYTSGFTASPVPFGAFPSLHAGNATLESLFLSLLFPKLRPAFIIYTAWLWWSTMYLSHHYAVDLIGGGFLAAVSFYFAKSRFIPRVQADKTFRWDYDYVEVGESPIDHGYDLANFRGDIHIDSDEWTVGSSSSVSSGSLSPVDEAQSLWDGETLGSNSDLEAGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.41
3 0.47
4 0.52
5 0.52
6 0.52
7 0.46
8 0.4
9 0.38
10 0.33
11 0.29
12 0.29
13 0.28
14 0.25
15 0.26
16 0.26
17 0.26
18 0.25
19 0.23
20 0.26
21 0.31
22 0.34
23 0.4
24 0.47
25 0.54
26 0.62
27 0.66
28 0.66
29 0.68
30 0.74
31 0.77
32 0.8
33 0.83
34 0.85
35 0.88
36 0.89
37 0.88
38 0.87
39 0.81
40 0.78
41 0.72
42 0.67
43 0.58
44 0.5
45 0.43
46 0.38
47 0.33
48 0.27
49 0.23
50 0.2
51 0.2
52 0.18
53 0.22
54 0.18
55 0.18
56 0.21
57 0.22
58 0.25
59 0.29
60 0.31
61 0.3
62 0.37
63 0.39
64 0.35
65 0.35
66 0.33
67 0.32
68 0.32
69 0.31
70 0.24
71 0.21
72 0.21
73 0.19
74 0.16
75 0.12
76 0.09
77 0.05
78 0.05
79 0.05
80 0.04
81 0.04
82 0.03
83 0.04
84 0.04
85 0.04
86 0.05
87 0.06
88 0.07
89 0.11
90 0.14
91 0.14
92 0.14
93 0.15
94 0.16
95 0.15
96 0.16
97 0.12
98 0.11
99 0.1
100 0.1
101 0.11
102 0.08
103 0.08
104 0.07
105 0.06
106 0.05
107 0.05
108 0.05
109 0.05
110 0.08
111 0.08
112 0.08
113 0.08
114 0.09
115 0.1
116 0.12
117 0.11
118 0.09
119 0.09
120 0.09
121 0.09
122 0.09
123 0.09
124 0.06
125 0.06
126 0.06
127 0.06
128 0.05
129 0.07
130 0.07
131 0.08
132 0.08
133 0.08
134 0.15
135 0.17
136 0.22
137 0.21
138 0.21
139 0.22
140 0.23
141 0.27
142 0.24
143 0.24
144 0.2
145 0.24
146 0.25
147 0.24
148 0.25
149 0.21
150 0.17
151 0.15
152 0.14
153 0.09
154 0.08
155 0.08
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.06
162 0.07
163 0.07
164 0.08
165 0.09
166 0.1
167 0.1
168 0.09
169 0.1
170 0.09
171 0.08
172 0.07
173 0.07
174 0.05
175 0.05
176 0.05
177 0.04
178 0.04
179 0.04
180 0.05
181 0.05
182 0.04
183 0.04
184 0.06
185 0.06
186 0.06
187 0.05
188 0.05
189 0.05
190 0.05
191 0.05
192 0.03
193 0.04
194 0.04
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.05
201 0.05
202 0.05
203 0.05
204 0.08
205 0.09
206 0.1
207 0.1
208 0.1
209 0.1
210 0.11
211 0.11
212 0.09
213 0.08
214 0.07
215 0.08
216 0.07
217 0.06
218 0.06
219 0.06
220 0.06
221 0.05
222 0.06
223 0.07
224 0.06
225 0.09
226 0.11
227 0.12
228 0.13
229 0.16
230 0.19
231 0.19
232 0.2
233 0.2
234 0.17
235 0.17
236 0.16
237 0.13
238 0.09
239 0.08
240 0.07
241 0.05
242 0.05
243 0.04
244 0.06
245 0.06
246 0.06
247 0.07
248 0.07
249 0.07
250 0.08
251 0.08
252 0.07
253 0.07
254 0.07
255 0.06
256 0.06
257 0.06
258 0.05
259 0.05
260 0.04
261 0.04
262 0.04
263 0.05
264 0.04
265 0.04
266 0.04
267 0.05
268 0.08
269 0.08
270 0.09
271 0.09
272 0.09
273 0.09
274 0.1
275 0.12
276 0.09
277 0.1
278 0.14
279 0.15
280 0.14
281 0.14
282 0.13
283 0.12
284 0.12
285 0.12
286 0.06
287 0.06
288 0.06
289 0.06
290 0.05
291 0.05
292 0.05
293 0.05
294 0.07
295 0.08
296 0.08
297 0.13
298 0.15
299 0.15
300 0.16
301 0.19
302 0.19
303 0.21
304 0.23
305 0.19
306 0.18
307 0.18
308 0.18
309 0.14
310 0.12
311 0.09
312 0.08
313 0.08
314 0.1
315 0.12
316 0.15
317 0.18
318 0.19
319 0.19
320 0.18
321 0.18
322 0.14
323 0.12
324 0.09
325 0.06
326 0.05
327 0.05
328 0.04
329 0.04
330 0.04
331 0.03
332 0.02
333 0.02
334 0.04
335 0.05
336 0.05
337 0.08
338 0.09
339 0.12
340 0.16
341 0.23
342 0.27
343 0.3
344 0.37
345 0.41
346 0.5
347 0.5
348 0.56
349 0.55
350 0.54
351 0.58
352 0.55
353 0.49
354 0.45
355 0.43
356 0.37
357 0.36
358 0.34
359 0.28
360 0.25
361 0.25
362 0.19
363 0.19
364 0.16
365 0.12
366 0.1
367 0.09
368 0.08
369 0.08
370 0.08
371 0.12
372 0.13
373 0.13
374 0.13
375 0.13
376 0.14
377 0.16
378 0.16
379 0.14
380 0.15
381 0.15
382 0.15
383 0.17
384 0.17
385 0.15
386 0.14
387 0.13
388 0.11
389 0.09
390 0.09
391 0.08
392 0.07
393 0.08
394 0.09
395 0.08
396 0.1
397 0.1
398 0.12
399 0.13
400 0.13
401 0.13
402 0.13
403 0.15
404 0.14
405 0.13
406 0.14
407 0.15
408 0.15
409 0.14
410 0.13
411 0.12
412 0.12
413 0.15
414 0.13
415 0.12
416 0.12
417 0.12
418 0.11