Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2K2A2

Protein Details
Accession I2K2A2   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-31ETEVKAKSRMQPSKKGKRAWRKNIDITDIHydrophilic
NLS Segment(s)
PositionSequence
9-24KSRMQPSKKGKRAWRK
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences MGETEVKAKSRMQPSKKGKRAWRKNIDITDIEDKLEERRQEVIEEGKPVEELEANELFYIDEEEDEHTVKKMKRDHIKPLRSTEILYQRSKAPGLVNERVESRRKKVENVFWXGNSQIDENIRKSSGXE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.77
3 0.82
4 0.83
5 0.83
6 0.84
7 0.89
8 0.89
9 0.89
10 0.86
11 0.87
12 0.83
13 0.78
14 0.68
15 0.62
16 0.57
17 0.47
18 0.38
19 0.29
20 0.24
21 0.22
22 0.26
23 0.21
24 0.16
25 0.19
26 0.2
27 0.2
28 0.22
29 0.23
30 0.2
31 0.21
32 0.2
33 0.17
34 0.16
35 0.15
36 0.14
37 0.1
38 0.08
39 0.1
40 0.1
41 0.1
42 0.1
43 0.1
44 0.09
45 0.08
46 0.08
47 0.04
48 0.04
49 0.04
50 0.05
51 0.06
52 0.07
53 0.07
54 0.07
55 0.12
56 0.13
57 0.18
58 0.23
59 0.31
60 0.4
61 0.45
62 0.55
63 0.61
64 0.68
65 0.67
66 0.67
67 0.65
68 0.56
69 0.52
70 0.48
71 0.47
72 0.45
73 0.41
74 0.37
75 0.34
76 0.35
77 0.34
78 0.29
79 0.22
80 0.23
81 0.29
82 0.33
83 0.33
84 0.32
85 0.35
86 0.37
87 0.42
88 0.41
89 0.4
90 0.44
91 0.44
92 0.5
93 0.56
94 0.62
95 0.65
96 0.68
97 0.66
98 0.58
99 0.6
100 0.53
101 0.45
102 0.36
103 0.27
104 0.24
105 0.25
106 0.25
107 0.25