Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NQ28

Protein Details
Accession A0A1B7NQ28   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-27DDLFKKPLLPSKRKPEPLRDASEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 13, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR013180  CTNNBL1_N  
Pfam View protein in Pfam  
PF08216  CTNNBL  
Amino Acid Sequences MANIDDLFKKPLLPSKRKPEPLRDASEVYKSAKVGANGDASSRRSAAVEDALDDEDEVGPELPPDFNPDEDIPDDEEGRFFGGGISRDTAGALDFVEKLDQGDTGPEKIDSVWLRRLALNFEKRISKNAELRAKFENEPQKQVQRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.58
3 0.68
4 0.76
5 0.8
6 0.82
7 0.82
8 0.81
9 0.79
10 0.73
11 0.66
12 0.59
13 0.57
14 0.49
15 0.42
16 0.36
17 0.28
18 0.26
19 0.25
20 0.24
21 0.21
22 0.21
23 0.21
24 0.19
25 0.21
26 0.21
27 0.2
28 0.2
29 0.19
30 0.16
31 0.13
32 0.14
33 0.14
34 0.13
35 0.11
36 0.11
37 0.12
38 0.12
39 0.11
40 0.11
41 0.09
42 0.06
43 0.06
44 0.06
45 0.05
46 0.04
47 0.04
48 0.05
49 0.05
50 0.05
51 0.09
52 0.09
53 0.09
54 0.12
55 0.12
56 0.13
57 0.13
58 0.14
59 0.12
60 0.11
61 0.12
62 0.09
63 0.09
64 0.07
65 0.07
66 0.06
67 0.05
68 0.05
69 0.06
70 0.08
71 0.09
72 0.1
73 0.09
74 0.09
75 0.09
76 0.09
77 0.07
78 0.06
79 0.05
80 0.05
81 0.05
82 0.05
83 0.06
84 0.05
85 0.06
86 0.06
87 0.06
88 0.05
89 0.08
90 0.09
91 0.1
92 0.11
93 0.1
94 0.1
95 0.1
96 0.16
97 0.15
98 0.18
99 0.23
100 0.24
101 0.26
102 0.27
103 0.29
104 0.29
105 0.36
106 0.4
107 0.37
108 0.39
109 0.45
110 0.44
111 0.49
112 0.49
113 0.47
114 0.47
115 0.53
116 0.6
117 0.54
118 0.56
119 0.56
120 0.54
121 0.49
122 0.5
123 0.51
124 0.46
125 0.51
126 0.55