Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7P6Q4

Protein Details
Accession A0A1B7P6Q4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
61-80MIRSNRKKAAKVKAASKKKAHydrophilic
NLS Segment(s)
PositionSequence
65-80NRKKAAKVKAASKKKA
Subcellular Location(s) mito 9, plas 8, cyto 3, extr 3, pero 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLLVATAVYLYYTAWTLLMPFVDDGHPLHDLFPPRVWAIRIPVILTLLGSAVVGSFLGVVMIRSNRKKAAKVKAASKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.07
5 0.07
6 0.07
7 0.07
8 0.08
9 0.08
10 0.09
11 0.09
12 0.1
13 0.11
14 0.1
15 0.11
16 0.13
17 0.15
18 0.15
19 0.16
20 0.16
21 0.15
22 0.16
23 0.16
24 0.14
25 0.15
26 0.17
27 0.16
28 0.15
29 0.15
30 0.14
31 0.13
32 0.12
33 0.08
34 0.05
35 0.04
36 0.04
37 0.03
38 0.03
39 0.03
40 0.03
41 0.02
42 0.02
43 0.02
44 0.03
45 0.03
46 0.03
47 0.05
48 0.09
49 0.16
50 0.19
51 0.23
52 0.3
53 0.35
54 0.43
55 0.49
56 0.57
57 0.61
58 0.65
59 0.72
60 0.75