Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7P289

Protein Details
Accession A0A1B7P289    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
11-36ARSSSRASSHRRSRSRDRHSTTSSRHHydrophilic
NLS Segment(s)
PositionSequence
81-87RAKPRSG
91-91R
93-95VRK
Subcellular Location(s) mito 14, plas 5, extr 4, vacu 2
Family & Domain DBs
Amino Acid Sequences MDWLYPFSGLARSSSRASSHRRSRSRDRHSTTSSRHSHSHSHSNGKSHSSPSLFNLGGHANRSTTSSLFSIGSAASSSSRRAKPRSGFIARTVRKIRRLFRHIMRYAQSHPLKVFFMVVMPLITGGVLQKLLAVVGVRLPPSLGGGHGSGFKGGNGGAGLSGILGGGGGGGAGLGESVSGLVSLAKMFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.31
4 0.39
5 0.46
6 0.52
7 0.6
8 0.66
9 0.71
10 0.78
11 0.83
12 0.86
13 0.86
14 0.84
15 0.82
16 0.82
17 0.82
18 0.78
19 0.77
20 0.72
21 0.66
22 0.61
23 0.56
24 0.56
25 0.54
26 0.57
27 0.52
28 0.56
29 0.54
30 0.56
31 0.54
32 0.52
33 0.49
34 0.41
35 0.41
36 0.33
37 0.31
38 0.29
39 0.32
40 0.26
41 0.24
42 0.23
43 0.21
44 0.2
45 0.21
46 0.18
47 0.13
48 0.13
49 0.15
50 0.14
51 0.12
52 0.13
53 0.12
54 0.12
55 0.12
56 0.12
57 0.1
58 0.09
59 0.09
60 0.07
61 0.07
62 0.06
63 0.07
64 0.1
65 0.16
66 0.2
67 0.24
68 0.28
69 0.34
70 0.37
71 0.44
72 0.5
73 0.49
74 0.46
75 0.49
76 0.56
77 0.5
78 0.53
79 0.52
80 0.46
81 0.49
82 0.53
83 0.53
84 0.52
85 0.57
86 0.57
87 0.58
88 0.64
89 0.58
90 0.57
91 0.53
92 0.47
93 0.44
94 0.46
95 0.4
96 0.32
97 0.3
98 0.28
99 0.25
100 0.22
101 0.2
102 0.1
103 0.09
104 0.08
105 0.08
106 0.06
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.03
113 0.04
114 0.04
115 0.03
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.06
123 0.08
124 0.08
125 0.08
126 0.08
127 0.08
128 0.09
129 0.09
130 0.07
131 0.08
132 0.08
133 0.09
134 0.11
135 0.11
136 0.11
137 0.11
138 0.1
139 0.09
140 0.09
141 0.09
142 0.07
143 0.07
144 0.06
145 0.05
146 0.05
147 0.04
148 0.04
149 0.03
150 0.03
151 0.02
152 0.02
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.03
166 0.03
167 0.03
168 0.04
169 0.04