Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NT07

Protein Details
Accession A0A1B7NT07   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
303-326GDREGRHHSRSPHRRRGERVDDVABasic
NLS Segment(s)
Subcellular Location(s) plas 13, extr 6, nucl 4, E.R. 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004345  TB2_DP1_HVA22  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF03134  TB2_DP1_HVA22  
Amino Acid Sequences MFGIIADLLSSALTILFPIFASYKALRSSDPSQLAPWLMYWVVMSIVLLVESWTYFIVGWFPFYSWIRLFALSYLVLPQTQGAKMLYQEYIDPFLLHHELEIEHFMSQAHESAKSAGLEYLYKAIDLIREKILGLPPTAAVAPPPQPPQAAGPAGFAQALLSRFSIPGTAAAASSLASPAADLYSILASAVGSAASSGKSRDMQAEELSASGKLIPDSIATASKAEQAEYIASQKERLGVLLSAFDREQRNLRLDPRGGSSDQDDLAYGSSGYDEYERGGGGLRKNRSDVSFENIEHEDLLTGDREGRHHSRSPHRRRGERVDDVADFAQRSVEEIARATGVYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.05
4 0.05
5 0.07
6 0.08
7 0.09
8 0.14
9 0.15
10 0.19
11 0.22
12 0.23
13 0.22
14 0.28
15 0.32
16 0.35
17 0.38
18 0.36
19 0.34
20 0.35
21 0.35
22 0.29
23 0.24
24 0.18
25 0.14
26 0.13
27 0.11
28 0.09
29 0.09
30 0.08
31 0.08
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.09
45 0.08
46 0.11
47 0.11
48 0.11
49 0.16
50 0.17
51 0.21
52 0.18
53 0.21
54 0.2
55 0.21
56 0.21
57 0.16
58 0.18
59 0.14
60 0.14
61 0.12
62 0.11
63 0.1
64 0.1
65 0.1
66 0.11
67 0.11
68 0.12
69 0.11
70 0.12
71 0.13
72 0.15
73 0.14
74 0.12
75 0.13
76 0.13
77 0.15
78 0.15
79 0.13
80 0.11
81 0.14
82 0.14
83 0.13
84 0.11
85 0.09
86 0.09
87 0.1
88 0.12
89 0.09
90 0.08
91 0.09
92 0.09
93 0.08
94 0.09
95 0.1
96 0.09
97 0.09
98 0.1
99 0.11
100 0.13
101 0.13
102 0.13
103 0.11
104 0.11
105 0.11
106 0.11
107 0.12
108 0.1
109 0.09
110 0.09
111 0.09
112 0.12
113 0.13
114 0.15
115 0.13
116 0.14
117 0.14
118 0.16
119 0.19
120 0.16
121 0.14
122 0.13
123 0.11
124 0.12
125 0.12
126 0.09
127 0.07
128 0.08
129 0.1
130 0.13
131 0.15
132 0.15
133 0.15
134 0.16
135 0.18
136 0.19
137 0.18
138 0.15
139 0.14
140 0.14
141 0.14
142 0.13
143 0.11
144 0.07
145 0.08
146 0.08
147 0.08
148 0.08
149 0.08
150 0.08
151 0.08
152 0.08
153 0.06
154 0.06
155 0.06
156 0.06
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.05
163 0.04
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.02
179 0.02
180 0.03
181 0.03
182 0.04
183 0.04
184 0.05
185 0.07
186 0.08
187 0.09
188 0.12
189 0.14
190 0.15
191 0.15
192 0.16
193 0.14
194 0.13
195 0.13
196 0.1
197 0.08
198 0.07
199 0.06
200 0.05
201 0.05
202 0.05
203 0.05
204 0.06
205 0.07
206 0.08
207 0.08
208 0.09
209 0.09
210 0.13
211 0.13
212 0.12
213 0.11
214 0.11
215 0.11
216 0.12
217 0.13
218 0.11
219 0.11
220 0.12
221 0.12
222 0.14
223 0.13
224 0.13
225 0.12
226 0.11
227 0.11
228 0.14
229 0.14
230 0.13
231 0.13
232 0.16
233 0.16
234 0.18
235 0.22
236 0.22
237 0.26
238 0.28
239 0.32
240 0.36
241 0.36
242 0.36
243 0.36
244 0.36
245 0.32
246 0.3
247 0.28
248 0.23
249 0.22
250 0.2
251 0.16
252 0.12
253 0.12
254 0.11
255 0.09
256 0.06
257 0.06
258 0.06
259 0.06
260 0.07
261 0.06
262 0.07
263 0.08
264 0.07
265 0.07
266 0.1
267 0.13
268 0.19
269 0.26
270 0.3
271 0.32
272 0.34
273 0.38
274 0.36
275 0.39
276 0.35
277 0.34
278 0.35
279 0.33
280 0.35
281 0.33
282 0.31
283 0.26
284 0.24
285 0.17
286 0.12
287 0.12
288 0.09
289 0.08
290 0.11
291 0.12
292 0.13
293 0.2
294 0.25
295 0.29
296 0.34
297 0.43
298 0.51
299 0.61
300 0.7
301 0.74
302 0.79
303 0.82
304 0.85
305 0.87
306 0.86
307 0.84
308 0.79
309 0.74
310 0.65
311 0.6
312 0.53
313 0.45
314 0.35
315 0.26
316 0.22
317 0.16
318 0.17
319 0.17
320 0.17
321 0.16
322 0.16
323 0.18
324 0.17