Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NR65

Protein Details
Accession A0A1B7NR65    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-32YIFAANEKEKQKRKRSTRRIPHQGGLTHydrophilic
NLS Segment(s)
PositionSequence
14-24EKQKRKRSTRR
Subcellular Location(s) nucl 14, cyto 5, mito 4, pero 2
Family & Domain DBs
Amino Acid Sequences MKQNQYIFAANEKEKQKRKRSTRRIPHQGGLTREEAQNLVIPPAEPVEQPVEQHVNPPELGGRLGWELR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.6
3 0.65
4 0.7
5 0.79
6 0.83
7 0.88
8 0.9
9 0.92
10 0.93
11 0.94
12 0.89
13 0.82
14 0.78
15 0.72
16 0.63
17 0.55
18 0.47
19 0.38
20 0.32
21 0.28
22 0.2
23 0.16
24 0.15
25 0.12
26 0.1
27 0.08
28 0.08
29 0.08
30 0.09
31 0.09
32 0.07
33 0.08
34 0.12
35 0.13
36 0.13
37 0.16
38 0.19
39 0.19
40 0.23
41 0.24
42 0.22
43 0.22
44 0.22
45 0.2
46 0.17
47 0.18
48 0.13
49 0.13