Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NME8

Protein Details
Accession A0A1B7NME8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPKNLHKIQKQISKKRGKLDSLHydrophilic
NLS Segment(s)
PositionSequence
13-21SKKRGKLDS
23-39HENSRDAKRLRRAGGRE
Subcellular Location(s) nucl 13, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR021346  Tma16  
IPR038356  Tma16_sf  
Pfam View protein in Pfam  
PF11176  Tma16  
Amino Acid Sequences MPKNLHKIQKQISKKRGKLDSLHENSRDAKRLRRAGGREHKLAVAAAVTMRGRQSFVDRVHFFQENVPEPPAPLSDGDIVQLITRFIARNQPELEQLQQERRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.8
4 0.76
5 0.71
6 0.69
7 0.7
8 0.66
9 0.67
10 0.59
11 0.54
12 0.53
13 0.51
14 0.49
15 0.4
16 0.41
17 0.43
18 0.49
19 0.52
20 0.55
21 0.54
22 0.57
23 0.66
24 0.64
25 0.57
26 0.52
27 0.47
28 0.39
29 0.36
30 0.25
31 0.14
32 0.09
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.07
40 0.07
41 0.11
42 0.15
43 0.17
44 0.25
45 0.26
46 0.27
47 0.3
48 0.31
49 0.28
50 0.24
51 0.28
52 0.23
53 0.23
54 0.23
55 0.2
56 0.19
57 0.2
58 0.18
59 0.14
60 0.11
61 0.11
62 0.11
63 0.11
64 0.11
65 0.11
66 0.1
67 0.1
68 0.1
69 0.08
70 0.07
71 0.08
72 0.08
73 0.09
74 0.18
75 0.2
76 0.25
77 0.27
78 0.29
79 0.32
80 0.35
81 0.36
82 0.35
83 0.38