Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JS01

Protein Details
Accession I2JS01    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-36ASKAPAKKTTIEPRKRSKPRKESWSSYIHydrophilic
NLS Segment(s)
PositionSequence
5-29EKKPASKAPAKKTTIEPRKRSKPRK
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MARAEKKPASKAPAKKTTIEPRKRSKPRKESWSSYIYKVLKQTHPDTGISRRAMSIMNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYTSSTSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.66
3 0.69
4 0.72
5 0.74
6 0.75
7 0.73
8 0.74
9 0.81
10 0.88
11 0.89
12 0.89
13 0.89
14 0.88
15 0.9
16 0.89
17 0.85
18 0.8
19 0.78
20 0.7
21 0.62
22 0.61
23 0.51
24 0.45
25 0.44
26 0.43
27 0.39
28 0.41
29 0.41
30 0.39
31 0.39
32 0.38
33 0.35
34 0.35
35 0.36
36 0.32
37 0.29
38 0.24
39 0.22
40 0.21
41 0.2
42 0.17
43 0.13
44 0.13
45 0.12
46 0.13
47 0.12
48 0.12
49 0.11
50 0.09
51 0.07
52 0.06
53 0.06
54 0.06
55 0.07
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.11
63 0.16
64 0.18
65 0.21
66 0.23
67 0.24
68 0.25
69 0.27
70 0.29
71 0.29
72 0.32
73 0.31
74 0.33
75 0.32
76 0.31
77 0.32
78 0.27
79 0.22
80 0.16
81 0.14
82 0.1
83 0.11
84 0.11
85 0.09
86 0.09
87 0.09
88 0.1
89 0.1
90 0.1
91 0.09
92 0.1
93 0.09
94 0.1
95 0.11
96 0.13
97 0.15
98 0.15
99 0.17
100 0.17
101 0.18
102 0.19