Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7P8R2

Protein Details
Accession A0A1B7P8R2    Localization Confidence High Confidence Score 24.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSSMRNAVQRRPHRERAQPSGREKWHydrophilic
38-63ARDYNVKKAKLQRLREKARDRNPDEFHydrophilic
201-220LAARRLKKRAAEVRRNKLEAHydrophilic
NLS Segment(s)
PositionSequence
44-54KKAKLQRLREK
175-217SGGEKPKQAHKSKKQIEAEERARKEMLAARRLKKRAAEVRRNK
255-263KWKIRERKK
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007144  SSU_processome_Utp11  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03998  Utp11  
Amino Acid Sequences MSSMRNAVQRRPHRERAQPSGREKWGILEKHKDYSLRARDYNVKKAKLQRLREKARDRNPDEFAFGMMSDKSKRQGHHGARGSETAAGLSHEAIKLLKTQDAGYLRVVGEKVRRQLEGVEQEARLQDGMSGALERKGRKIVFADSLEEQRRLRAEKRETEEEDDEEEMVEERKLSGGEKPKQAHKSKKQIEAEERARKEMLAARRLKKRAAEVRRNKLEALRIQHKELLAAEQELDRQRAKMENSVGGVNKYGIKWKIRERKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.83
4 0.84
5 0.82
6 0.81
7 0.8
8 0.75
9 0.68
10 0.59
11 0.56
12 0.54
13 0.51
14 0.5
15 0.5
16 0.5
17 0.52
18 0.55
19 0.49
20 0.45
21 0.49
22 0.52
23 0.49
24 0.47
25 0.47
26 0.54
27 0.59
28 0.65
29 0.63
30 0.57
31 0.57
32 0.65
33 0.71
34 0.7
35 0.73
36 0.74
37 0.76
38 0.82
39 0.86
40 0.86
41 0.86
42 0.87
43 0.87
44 0.82
45 0.79
46 0.74
47 0.65
48 0.58
49 0.48
50 0.38
51 0.28
52 0.22
53 0.17
54 0.12
55 0.13
56 0.12
57 0.13
58 0.19
59 0.22
60 0.23
61 0.29
62 0.39
63 0.43
64 0.52
65 0.57
66 0.53
67 0.51
68 0.51
69 0.44
70 0.35
71 0.28
72 0.18
73 0.11
74 0.09
75 0.08
76 0.07
77 0.07
78 0.06
79 0.07
80 0.07
81 0.07
82 0.09
83 0.1
84 0.11
85 0.11
86 0.11
87 0.16
88 0.18
89 0.19
90 0.17
91 0.17
92 0.16
93 0.16
94 0.16
95 0.13
96 0.16
97 0.18
98 0.23
99 0.23
100 0.23
101 0.22
102 0.23
103 0.27
104 0.27
105 0.25
106 0.23
107 0.21
108 0.21
109 0.21
110 0.19
111 0.13
112 0.09
113 0.07
114 0.05
115 0.05
116 0.04
117 0.04
118 0.04
119 0.08
120 0.1
121 0.1
122 0.12
123 0.16
124 0.16
125 0.17
126 0.19
127 0.19
128 0.22
129 0.22
130 0.23
131 0.2
132 0.25
133 0.26
134 0.25
135 0.23
136 0.19
137 0.2
138 0.21
139 0.24
140 0.28
141 0.32
142 0.38
143 0.45
144 0.5
145 0.5
146 0.52
147 0.5
148 0.42
149 0.38
150 0.3
151 0.24
152 0.17
153 0.15
154 0.09
155 0.08
156 0.07
157 0.05
158 0.05
159 0.06
160 0.06
161 0.07
162 0.12
163 0.21
164 0.26
165 0.34
166 0.37
167 0.44
168 0.53
169 0.61
170 0.66
171 0.66
172 0.72
173 0.73
174 0.79
175 0.78
176 0.76
177 0.76
178 0.75
179 0.74
180 0.73
181 0.66
182 0.59
183 0.53
184 0.45
185 0.4
186 0.37
187 0.35
188 0.34
189 0.41
190 0.45
191 0.54
192 0.57
193 0.58
194 0.56
195 0.58
196 0.6
197 0.63
198 0.67
199 0.68
200 0.77
201 0.81
202 0.79
203 0.7
204 0.64
205 0.6
206 0.56
207 0.54
208 0.53
209 0.48
210 0.49
211 0.51
212 0.47
213 0.41
214 0.36
215 0.3
216 0.22
217 0.2
218 0.18
219 0.16
220 0.2
221 0.21
222 0.23
223 0.2
224 0.19
225 0.21
226 0.26
227 0.28
228 0.3
229 0.32
230 0.33
231 0.34
232 0.38
233 0.38
234 0.33
235 0.31
236 0.26
237 0.25
238 0.21
239 0.27
240 0.28
241 0.32
242 0.38
243 0.47