Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7P3N1

Protein Details
Accession A0A1B7P3N1    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-44TQPTSHPRSPRRKPKAEQSEKSRRPRLBasic
NLS Segment(s)
PositionSequence
24-83PRSPRRKPKAEQSEKSRRPRLVEKTGAEKREEEMRGMTPELRARLERERRARAAEERIRR
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPSASPAMISANQDGTGTQPTSHPRSPRRKPKAEQSEKSRRPRLVEKTGAEKREEEMRGMTPELRARLERERRARAAEERIRRMQAGAGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.16
4 0.15
5 0.13
6 0.15
7 0.21
8 0.27
9 0.32
10 0.37
11 0.43
12 0.53
13 0.63
14 0.71
15 0.76
16 0.79
17 0.8
18 0.83
19 0.85
20 0.85
21 0.82
22 0.81
23 0.82
24 0.81
25 0.84
26 0.8
27 0.7
28 0.65
29 0.65
30 0.63
31 0.6
32 0.58
33 0.51
34 0.54
35 0.57
36 0.53
37 0.46
38 0.38
39 0.32
40 0.33
41 0.32
42 0.23
43 0.2
44 0.21
45 0.21
46 0.22
47 0.21
48 0.16
49 0.19
50 0.2
51 0.2
52 0.19
53 0.21
54 0.31
55 0.39
56 0.46
57 0.51
58 0.57
59 0.58
60 0.61
61 0.62
62 0.59
63 0.6
64 0.6
65 0.61
66 0.61
67 0.63
68 0.61
69 0.57
70 0.51