Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NW63

Protein Details
Accession A0A1B7NW63   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
46-84AGEKVEKASRQQRKQRKNRSKKFRGTEKTKGPKKDKKGKBasic
NLS Segment(s)
PositionSequence
46-84AGEKVEKASRQQRKQRKNRSKKFRGTEKTKGPKKDKKGK
Subcellular Location(s) mito 20, nucl 7
Family & Domain DBs
Amino Acid Sequences MKNTFGLSLRLAIAPGFSKYSSLIEGSQFLTLKKFEPRYRLVRIGAGEKVEKASRQQRKQRKNRSKKFRGTEKTKGPKKDKKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.11
5 0.12
6 0.13
7 0.14
8 0.14
9 0.14
10 0.13
11 0.12
12 0.14
13 0.14
14 0.15
15 0.14
16 0.13
17 0.13
18 0.13
19 0.14
20 0.18
21 0.24
22 0.25
23 0.3
24 0.35
25 0.4
26 0.45
27 0.46
28 0.41
29 0.37
30 0.36
31 0.33
32 0.28
33 0.24
34 0.19
35 0.15
36 0.16
37 0.14
38 0.14
39 0.16
40 0.25
41 0.33
42 0.42
43 0.52
44 0.61
45 0.71
46 0.81
47 0.87
48 0.89
49 0.91
50 0.93
51 0.94
52 0.94
53 0.94
54 0.93
55 0.92
56 0.91
57 0.89
58 0.88
59 0.88
60 0.88
61 0.86
62 0.86
63 0.86
64 0.85