Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7P3G7

Protein Details
Accession A0A1B7P3G7    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-21FRYPKRSSVQHLRIHPRRPTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, cyto_mito 10.833, nucl 5.5, cyto_nucl 5.333, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR028427  Met_Sox_Rdtase_MsrB  
IPR002579  Met_Sox_Rdtase_MsrB_dom  
IPR011057  Mss4-like_sf  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0033743  F:peptide-methionine (R)-S-oxide reductase activity  
GO:0030091  P:protein repair  
GO:0006979  P:response to oxidative stress  
Pfam View protein in Pfam  
PF01641  SelR  
PROSITE View protein in PROSITE  
PS51790  MSRB  
Amino Acid Sequences MFRYPKRSSVQHLRIHPRRPTSNLSRQLAPNRTPFRLGLPRFAAGRRSSPTRPKAVLSSSILTIPFLTAARFSSSNKNTGNMEFPDKRTDEEWQMVLTQEQFRILRNKGTEPPGSGKYDKHAPSSGIYECAGCGSPLYKAAHKFSSGCGWPAYFDSIPGAVTRKEDRSFGMNRTEILCSNCGGHLGHVFKGEGYRTPTDERHCVNSISLRFTEDESKVKEGDKKEEGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.79
4 0.77
5 0.74
6 0.72
7 0.71
8 0.7
9 0.72
10 0.73
11 0.7
12 0.66
13 0.66
14 0.69
15 0.67
16 0.62
17 0.61
18 0.57
19 0.55
20 0.52
21 0.47
22 0.46
23 0.49
24 0.46
25 0.44
26 0.42
27 0.42
28 0.41
29 0.42
30 0.39
31 0.32
32 0.35
33 0.32
34 0.35
35 0.39
36 0.47
37 0.52
38 0.54
39 0.53
40 0.5
41 0.5
42 0.47
43 0.46
44 0.4
45 0.36
46 0.29
47 0.29
48 0.26
49 0.22
50 0.18
51 0.13
52 0.1
53 0.08
54 0.07
55 0.07
56 0.08
57 0.1
58 0.12
59 0.14
60 0.22
61 0.24
62 0.3
63 0.3
64 0.31
65 0.29
66 0.3
67 0.32
68 0.24
69 0.29
70 0.26
71 0.27
72 0.29
73 0.28
74 0.28
75 0.26
76 0.27
77 0.23
78 0.23
79 0.21
80 0.17
81 0.17
82 0.16
83 0.15
84 0.13
85 0.11
86 0.09
87 0.11
88 0.11
89 0.12
90 0.17
91 0.18
92 0.2
93 0.2
94 0.23
95 0.25
96 0.29
97 0.28
98 0.25
99 0.28
100 0.27
101 0.29
102 0.27
103 0.23
104 0.22
105 0.28
106 0.27
107 0.26
108 0.25
109 0.22
110 0.23
111 0.25
112 0.23
113 0.17
114 0.16
115 0.13
116 0.11
117 0.11
118 0.1
119 0.07
120 0.06
121 0.05
122 0.05
123 0.1
124 0.12
125 0.14
126 0.17
127 0.2
128 0.22
129 0.23
130 0.23
131 0.2
132 0.24
133 0.22
134 0.21
135 0.18
136 0.17
137 0.16
138 0.17
139 0.19
140 0.13
141 0.12
142 0.12
143 0.12
144 0.12
145 0.12
146 0.13
147 0.09
148 0.12
149 0.15
150 0.19
151 0.2
152 0.21
153 0.22
154 0.26
155 0.29
156 0.29
157 0.33
158 0.29
159 0.29
160 0.3
161 0.3
162 0.26
163 0.25
164 0.23
165 0.17
166 0.17
167 0.16
168 0.15
169 0.14
170 0.13
171 0.16
172 0.17
173 0.18
174 0.18
175 0.18
176 0.17
177 0.19
178 0.19
179 0.18
180 0.21
181 0.23
182 0.25
183 0.29
184 0.34
185 0.37
186 0.42
187 0.42
188 0.43
189 0.42
190 0.4
191 0.38
192 0.41
193 0.38
194 0.37
195 0.34
196 0.3
197 0.28
198 0.3
199 0.34
200 0.3
201 0.33
202 0.32
203 0.34
204 0.34
205 0.36
206 0.4
207 0.38
208 0.43