Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7NQ46

Protein Details
Accession A0A1B7NQ46    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-30VWKSRADGKRTRVKRKNSPMAPLHydrophilic
NLS Segment(s)
PositionSequence
15-23GKRTRVKRK
Subcellular Location(s) mito 15, cyto 7, nucl 5
Family & Domain DBs
Amino Acid Sequences MTQPPKYVWKSRADGKRTRVKRKNSPMAPLESIAIGVRRESQAVVAPIIKMPGAPDKFRSALIGLGKPFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.66
3 0.71
4 0.72
5 0.78
6 0.77
7 0.77
8 0.81
9 0.84
10 0.87
11 0.8
12 0.78
13 0.71
14 0.67
15 0.59
16 0.49
17 0.38
18 0.27
19 0.23
20 0.16
21 0.13
22 0.08
23 0.07
24 0.07
25 0.07
26 0.08
27 0.07
28 0.08
29 0.1
30 0.11
31 0.12
32 0.11
33 0.11
34 0.11
35 0.12
36 0.11
37 0.07
38 0.08
39 0.16
40 0.19
41 0.2
42 0.23
43 0.28
44 0.29
45 0.3
46 0.3
47 0.23
48 0.24
49 0.27
50 0.29