Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8DMB5

Protein Details
Accession A0A1B8DMB5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
59-83TWKGHENKVVSKRKKKLTKGLEFLPHydrophilic
NLS Segment(s)
PositionSequence
70-74KRKKK
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR032466  Metal_Hydrolase  
IPR001130  TatD-like  
Gene Ontology GO:0016788  F:hydrolase activity, acting on ester bonds  
Pfam View protein in Pfam  
PF01026  TatD_DNase  
Amino Acid Sequences MAITPGGREGRRLTQYRVNMVHQKQILRAQLRLAGELQRAVSVHGVGAHGFLYEALEETWKGHENKVVSKRKKKLTKGLEFLPDEEACIHILE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.51
3 0.55
4 0.55
5 0.53
6 0.53
7 0.51
8 0.53
9 0.48
10 0.45
11 0.41
12 0.42
13 0.43
14 0.37
15 0.36
16 0.3
17 0.31
18 0.3
19 0.27
20 0.23
21 0.18
22 0.16
23 0.16
24 0.15
25 0.11
26 0.11
27 0.1
28 0.09
29 0.07
30 0.06
31 0.06
32 0.06
33 0.05
34 0.06
35 0.05
36 0.04
37 0.04
38 0.04
39 0.04
40 0.03
41 0.04
42 0.04
43 0.04
44 0.05
45 0.05
46 0.08
47 0.12
48 0.13
49 0.13
50 0.16
51 0.18
52 0.27
53 0.36
54 0.45
55 0.5
56 0.59
57 0.67
58 0.75
59 0.82
60 0.82
61 0.83
62 0.83
63 0.84
64 0.81
65 0.78
66 0.76
67 0.68
68 0.61
69 0.56
70 0.45
71 0.35
72 0.29
73 0.24