Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2K1I0

Protein Details
Accession I2K1I0    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPEKLSRKERKKRRVEEDSSSSEBasic
NLS Segment(s)
PositionSequence
6-14SRKERKKRR
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MPEKLSRKERKKRRVEEDSSSSESSSSEISELEEDIXDEEQEAEANTSISELDTTNVKDDTAGENCEIITKRHTGNPEKYKKDRGSISRYEEAGDGSGXWRGX
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.87
3 0.86
4 0.82
5 0.78
6 0.72
7 0.63
8 0.52
9 0.41
10 0.34
11 0.26
12 0.19
13 0.12
14 0.07
15 0.07
16 0.07
17 0.08
18 0.08
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.06
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.06
40 0.06
41 0.08
42 0.08
43 0.08
44 0.07
45 0.08
46 0.11
47 0.12
48 0.13
49 0.11
50 0.12
51 0.12
52 0.15
53 0.15
54 0.12
55 0.13
56 0.15
57 0.16
58 0.2
59 0.27
60 0.31
61 0.4
62 0.5
63 0.57
64 0.63
65 0.67
66 0.73
67 0.71
68 0.7
69 0.69
70 0.66
71 0.65
72 0.65
73 0.67
74 0.63
75 0.59
76 0.53
77 0.45
78 0.38
79 0.31
80 0.23