Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JWU4

Protein Details
Accession I2JWU4   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
106-126TRPEVFKTRRGGERRRRYQSNBasic
NLS Segment(s)
PositionSequence
121-129RRGGERRXR
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MYGLNNDSHQNKLVQTSTLAKVDGENFSFTEPSLAKPTKGATGQPLEEPPNSVSKKELNLGLRKRRLTPEERDDARQNEYLEHKKEKIYTXGLXTRSSEXITRLSELRTRPEVXXXXFKTRRGGERRXRRYXQSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.26
4 0.27
5 0.27
6 0.26
7 0.21
8 0.21
9 0.23
10 0.23
11 0.19
12 0.17
13 0.15
14 0.16
15 0.16
16 0.14
17 0.15
18 0.13
19 0.14
20 0.2
21 0.21
22 0.2
23 0.21
24 0.22
25 0.23
26 0.24
27 0.23
28 0.2
29 0.23
30 0.24
31 0.24
32 0.25
33 0.23
34 0.22
35 0.23
36 0.19
37 0.23
38 0.22
39 0.21
40 0.2
41 0.2
42 0.22
43 0.22
44 0.25
45 0.22
46 0.29
47 0.36
48 0.42
49 0.46
50 0.45
51 0.46
52 0.46
53 0.47
54 0.45
55 0.45
56 0.44
57 0.47
58 0.48
59 0.49
60 0.49
61 0.45
62 0.43
63 0.38
64 0.32
65 0.26
66 0.3
67 0.32
68 0.33
69 0.35
70 0.33
71 0.33
72 0.34
73 0.34
74 0.33
75 0.32
76 0.33
77 0.34
78 0.38
79 0.37
80 0.36
81 0.36
82 0.33
83 0.31
84 0.27
85 0.24
86 0.21
87 0.21
88 0.23
89 0.26
90 0.26
91 0.3
92 0.34
93 0.35
94 0.35
95 0.42
96 0.48
97 0.49
98 0.56
99 0.57
100 0.58
101 0.64
102 0.7
103 0.73
104 0.74
105 0.79
106 0.81