Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8DTM9

Protein Details
Accession A0A1B8DTM9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
43-66TEGEICPDGKRRRRKRCAPEVATDHydrophilic
NLS Segment(s)
PositionSequence
52-57KRRRRK
Subcellular Location(s) extr 10, mito 7, E.R. 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MPPHLHPRSRMTSSIFVTTLLASFAVVTLPHVLPCPAPRVAYTEGEICPDGKRRRRKRCAPEVATDGLVKEGKPCATTVAIGGGEDLEEIVGTREKRECPIPKPGGTVGRILAFTGIGGNTDGPGGTRPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.41
3 0.33
4 0.3
5 0.26
6 0.2
7 0.14
8 0.11
9 0.07
10 0.06
11 0.06
12 0.05
13 0.05
14 0.05
15 0.08
16 0.09
17 0.09
18 0.1
19 0.1
20 0.11
21 0.13
22 0.16
23 0.14
24 0.15
25 0.15
26 0.19
27 0.22
28 0.22
29 0.22
30 0.21
31 0.19
32 0.2
33 0.2
34 0.16
35 0.14
36 0.21
37 0.27
38 0.33
39 0.43
40 0.53
41 0.64
42 0.73
43 0.82
44 0.84
45 0.88
46 0.9
47 0.84
48 0.78
49 0.71
50 0.62
51 0.53
52 0.42
53 0.31
54 0.21
55 0.17
56 0.12
57 0.09
58 0.09
59 0.08
60 0.09
61 0.09
62 0.1
63 0.1
64 0.1
65 0.09
66 0.1
67 0.09
68 0.09
69 0.09
70 0.06
71 0.06
72 0.05
73 0.05
74 0.02
75 0.02
76 0.02
77 0.04
78 0.07
79 0.07
80 0.1
81 0.13
82 0.14
83 0.17
84 0.26
85 0.31
86 0.33
87 0.43
88 0.48
89 0.46
90 0.49
91 0.51
92 0.48
93 0.44
94 0.41
95 0.32
96 0.28
97 0.26
98 0.22
99 0.18
100 0.12
101 0.11
102 0.1
103 0.08
104 0.07
105 0.07
106 0.07
107 0.07
108 0.07
109 0.07
110 0.07
111 0.09