Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JSI9

Protein Details
Accession I2JSI9   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-41TEQSQQQQDNKPKKKRFEVKKWTAVAFHydrophilic
NLS Segment(s)
PositionSequence
27-29KKK
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR024766  Znf_RING_H2  
Gene Ontology GO:0008270  F:zinc ion binding  
GO:0016567  P:protein ubiquitination  
Pfam View protein in Pfam  
PF12678  zf-rbx1  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
Amino Acid Sequences MSDQMDVDSLEATPTEQSQQQQDNKPKKKRFEVKKWTAVAFWSWDQSNETCAICRNHLMEPCIDCAATGKDRSNCPRAVGMCNHSFHLHCIDTWIKTRNSCPLDSSDWSLKEVIQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.12
4 0.14
5 0.2
6 0.28
7 0.35
8 0.43
9 0.53
10 0.61
11 0.68
12 0.77
13 0.79
14 0.8
15 0.83
16 0.84
17 0.85
18 0.85
19 0.86
20 0.86
21 0.87
22 0.81
23 0.71
24 0.62
25 0.52
26 0.42
27 0.34
28 0.25
29 0.19
30 0.16
31 0.15
32 0.17
33 0.16
34 0.16
35 0.13
36 0.13
37 0.11
38 0.14
39 0.15
40 0.13
41 0.15
42 0.15
43 0.16
44 0.18
45 0.18
46 0.17
47 0.17
48 0.18
49 0.16
50 0.14
51 0.11
52 0.11
53 0.12
54 0.13
55 0.13
56 0.16
57 0.19
58 0.24
59 0.29
60 0.33
61 0.31
62 0.31
63 0.34
64 0.32
65 0.33
66 0.33
67 0.33
68 0.33
69 0.34
70 0.33
71 0.3
72 0.28
73 0.25
74 0.26
75 0.22
76 0.16
77 0.2
78 0.21
79 0.22
80 0.27
81 0.31
82 0.28
83 0.3
84 0.33
85 0.38
86 0.4
87 0.38
88 0.36
89 0.36
90 0.39
91 0.4
92 0.43
93 0.41
94 0.38
95 0.38
96 0.36