Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8E664

Protein Details
Accession A0A1B8E664   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
132-159VTAGKDKQAPPQKKKKVKKVKLSFGDDEHydrophilic
NLS Segment(s)
PositionSequence
73-115KKGGKKGEEAAEEAKPEAVGGPERKEEKIAAIGATRKRKVGKV
136-152KDKQAPPQKKKKVKKVK
Subcellular Location(s) mito 12.5, cyto_mito 9.833, nucl 7.5, cyto_nucl 7.333, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSPKITSKSLSYDVSLPPFLQRLRAENTGASTAAPRPKRAPNPDADEEDEPVYVDEEGGALDEAELRSLGVTKKGGKKGEEAAEEAKPEAVGGPERKEEKIAAIGATRKRKVGKVIGAPEEEEGKGGDTAAVTAGKDKQAPPQKKKKVKKVKLSFGDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.26
4 0.23
5 0.26
6 0.24
7 0.26
8 0.25
9 0.26
10 0.31
11 0.34
12 0.33
13 0.3
14 0.33
15 0.28
16 0.26
17 0.21
18 0.17
19 0.18
20 0.24
21 0.25
22 0.26
23 0.29
24 0.38
25 0.47
26 0.53
27 0.54
28 0.54
29 0.6
30 0.61
31 0.6
32 0.55
33 0.47
34 0.41
35 0.36
36 0.28
37 0.2
38 0.15
39 0.12
40 0.08
41 0.07
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.05
56 0.06
57 0.07
58 0.09
59 0.14
60 0.21
61 0.26
62 0.29
63 0.28
64 0.3
65 0.33
66 0.36
67 0.32
68 0.27
69 0.25
70 0.23
71 0.22
72 0.2
73 0.15
74 0.1
75 0.08
76 0.07
77 0.05
78 0.08
79 0.09
80 0.12
81 0.15
82 0.17
83 0.18
84 0.18
85 0.18
86 0.16
87 0.17
88 0.16
89 0.13
90 0.14
91 0.19
92 0.24
93 0.31
94 0.3
95 0.31
96 0.33
97 0.35
98 0.39
99 0.42
100 0.43
101 0.44
102 0.5
103 0.5
104 0.49
105 0.46
106 0.41
107 0.35
108 0.28
109 0.2
110 0.13
111 0.11
112 0.1
113 0.09
114 0.08
115 0.06
116 0.06
117 0.07
118 0.08
119 0.06
120 0.09
121 0.11
122 0.13
123 0.15
124 0.16
125 0.25
126 0.34
127 0.45
128 0.52
129 0.62
130 0.71
131 0.79
132 0.89
133 0.91
134 0.92
135 0.92
136 0.93
137 0.93
138 0.93
139 0.92