Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2JSX3

Protein Details
Accession I2JSX3    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-34EEFGFYYPRTNKPRRKRQPKEVVDNDGWHydrophilic
NLS Segment(s)
PositionSequence
19-24KPRRKR
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR031456  Caf20  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005845  C:mRNA cap binding complex  
GO:0003743  F:translation initiation factor activity  
GO:0017148  P:negative regulation of translation  
Pfam View protein in Pfam  
PF17052  CAF20  
Amino Acid Sequences MRRDRREEXFGFYYPRTNKPRRKRQPKEVVDNDGWTSLVPKKHAQSSAEAAAAEEKAEEFEKSEQVRSFKTNTAKISSGKTGTASTKDTVAIAHVSRFNAFDALNEEDDSDQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.59
3 0.64
4 0.65
5 0.7
6 0.8
7 0.82
8 0.89
9 0.91
10 0.93
11 0.94
12 0.93
13 0.93
14 0.88
15 0.84
16 0.75
17 0.67
18 0.56
19 0.45
20 0.35
21 0.24
22 0.2
23 0.16
24 0.16
25 0.17
26 0.19
27 0.22
28 0.26
29 0.3
30 0.29
31 0.29
32 0.3
33 0.3
34 0.27
35 0.24
36 0.19
37 0.16
38 0.15
39 0.11
40 0.07
41 0.04
42 0.05
43 0.05
44 0.05
45 0.06
46 0.07
47 0.11
48 0.12
49 0.15
50 0.16
51 0.18
52 0.2
53 0.21
54 0.23
55 0.24
56 0.29
57 0.31
58 0.32
59 0.34
60 0.35
61 0.34
62 0.35
63 0.33
64 0.29
65 0.25
66 0.24
67 0.22
68 0.22
69 0.23
70 0.22
71 0.19
72 0.19
73 0.19
74 0.17
75 0.15
76 0.14
77 0.14
78 0.12
79 0.15
80 0.16
81 0.17
82 0.17
83 0.18
84 0.18
85 0.16
86 0.16
87 0.14
88 0.16
89 0.19
90 0.2
91 0.19
92 0.19