Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2K1N1

Protein Details
Accession I2K1N1   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
59-79IKANFKKKVLALKNQNKKVKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, mito_nucl 13.833, cyto_nucl 11.666, mito 5
Family & Domain DBs
Amino Acid Sequences MNIWSVQAPKKSTTMKSETLKVKNEKEILKVKNDKENVKVAKVKNSKVSSGSKMSSDQIKANFKKKVLALKNQNKKVKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.48
3 0.5
4 0.55
5 0.57
6 0.57
7 0.6
8 0.59
9 0.57
10 0.55
11 0.56
12 0.5
13 0.48
14 0.51
15 0.46
16 0.48
17 0.51
18 0.48
19 0.5
20 0.52
21 0.48
22 0.43
23 0.48
24 0.41
25 0.38
26 0.41
27 0.35
28 0.4
29 0.43
30 0.42
31 0.43
32 0.43
33 0.4
34 0.39
35 0.42
36 0.37
37 0.37
38 0.36
39 0.29
40 0.28
41 0.29
42 0.29
43 0.27
44 0.26
45 0.28
46 0.37
47 0.4
48 0.46
49 0.49
50 0.45
51 0.48
52 0.49
53 0.52
54 0.5
55 0.56
56 0.6
57 0.66
58 0.76
59 0.8