Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8E9Y5

Protein Details
Accession A0A1B8E9Y5   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
80-114AITKSRGKGPPKKKRTAAESKKLKGKKKVSTEEATHydrophilic
NLS Segment(s)
PositionSequence
83-107KSRGKGPPKKKRTAAESKKLKGKKK
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSVPRSRVVDLIKTQCKIFSTAFNPERLRTGNKILRQRLKGPVLAAYYPRRVATLKDLRKAYPQLKTWNEKEETRLENVAITKSRGKGPPKKKRTAAESKKLKGKKKVSTEEAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.41
4 0.38
5 0.32
6 0.3
7 0.28
8 0.37
9 0.39
10 0.43
11 0.43
12 0.4
13 0.42
14 0.38
15 0.38
16 0.32
17 0.39
18 0.39
19 0.44
20 0.52
21 0.57
22 0.62
23 0.61
24 0.62
25 0.61
26 0.57
27 0.52
28 0.44
29 0.39
30 0.33
31 0.3
32 0.29
33 0.24
34 0.23
35 0.22
36 0.22
37 0.19
38 0.17
39 0.17
40 0.23
41 0.3
42 0.32
43 0.37
44 0.38
45 0.38
46 0.41
47 0.45
48 0.4
49 0.37
50 0.36
51 0.39
52 0.43
53 0.48
54 0.46
55 0.48
56 0.47
57 0.41
58 0.41
59 0.39
60 0.36
61 0.33
62 0.31
63 0.24
64 0.23
65 0.24
66 0.23
67 0.18
68 0.19
69 0.2
70 0.21
71 0.26
72 0.3
73 0.38
74 0.45
75 0.55
76 0.63
77 0.69
78 0.77
79 0.79
80 0.81
81 0.82
82 0.83
83 0.82
84 0.82
85 0.83
86 0.81
87 0.83
88 0.82
89 0.82
90 0.81
91 0.8
92 0.79
93 0.79
94 0.82