Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JRL3

Protein Details
Accession I2JRL3   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
17-36QIVAQARKCKQQKKDAKAEIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.333, mito_nucl 11.166, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005124  V-ATPase_G  
Gene Ontology GO:0016471  C:vacuolar proton-transporting V-type ATPase complex  
GO:0046961  F:proton-transporting ATPase activity, rotational mechanism  
Pfam View protein in Pfam  
PF03179  V-ATPase_G  
Amino Acid Sequences MSGGIQSLLKTEKDAQQIVAQARKCKQQKKDAKAEIDSYKSSKSDELKKFEDEFVGANKKAEQDAEKQVQGELESIRKTAASKKDAVVKLLTEAVSTPNPELPRNIKKVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.29
4 0.34
5 0.35
6 0.37
7 0.34
8 0.35
9 0.37
10 0.45
11 0.49
12 0.52
13 0.57
14 0.62
15 0.69
16 0.72
17 0.8
18 0.78
19 0.76
20 0.71
21 0.68
22 0.61
23 0.54
24 0.47
25 0.38
26 0.32
27 0.26
28 0.24
29 0.22
30 0.23
31 0.3
32 0.34
33 0.38
34 0.39
35 0.42
36 0.43
37 0.39
38 0.35
39 0.25
40 0.2
41 0.17
42 0.18
43 0.15
44 0.14
45 0.14
46 0.14
47 0.14
48 0.14
49 0.13
50 0.13
51 0.2
52 0.23
53 0.23
54 0.23
55 0.23
56 0.22
57 0.2
58 0.17
59 0.12
60 0.12
61 0.12
62 0.12
63 0.11
64 0.11
65 0.12
66 0.18
67 0.25
68 0.25
69 0.27
70 0.3
71 0.39
72 0.4
73 0.41
74 0.36
75 0.29
76 0.27
77 0.27
78 0.24
79 0.15
80 0.14
81 0.16
82 0.16
83 0.17
84 0.16
85 0.18
86 0.2
87 0.21
88 0.26
89 0.32
90 0.39
91 0.44