Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8E5J3

Protein Details
Accession A0A1B8E5J3   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
364-383ACKNRKCTARHPSPAQKLAHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 9.833, cyto 7, cyto_mito 5.833, mito 3.5, extr 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR040366  Nab2/ZC3H14  
IPR043094  Nab2/ZC3H14_N_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0008143  F:poly(A) binding  
GO:1900364  P:negative regulation of mRNA polyadenylation  
GO:0043488  P:regulation of mRNA stability  
Pfam View protein in Pfam  
PF14608  zf-CCCH_2  
Amino Acid Sequences MSVAIPNESITAALNDAIQPKLAEIGWSTGGTDDSALAEYIILMLANGKTQDQIAAELSGDLLNLGPDDPGAKEFAHWLFEQVAILTQQQNGGAAHQNGVAGQGQAEAADGGNDEVMGDASEAGDPNVPTGPKSMRTGGAGMNRGRDRRMLGQLQKNLDGKDSVLHRVRAHGGNERIGGRGAPTGPRGNMQQRGGRFGAMGGMQGGPAGGNMMTPAQQMEMFRMMQQMFTPEQHASMMAGNGGQMPMGGMPPYQQQQGRSQGRSLFDRVQPNRGQGQQQFNKNRPPFQQHPHQQQQQQHHQQPAAPISPMDMVLTPAHDPASPDSTCKFNLSCTNATCKFAHQSPAAPPGTTIDVTDTCAFGAACKNRKCTARHPSPAQKLAHNAEQDCKFFPNCTNARCPFRHPAARLCRNGADCTEEGCKFTHVKTMCRFNPCLNPQCAFRHEEGQRRGKFEDKVWVAGEEGKHVSERRFVDEGEQVEELIVPGNTGGDSELAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.14
4 0.14
5 0.14
6 0.13
7 0.13
8 0.15
9 0.14
10 0.13
11 0.12
12 0.15
13 0.16
14 0.16
15 0.16
16 0.14
17 0.15
18 0.14
19 0.13
20 0.09
21 0.08
22 0.09
23 0.08
24 0.08
25 0.07
26 0.06
27 0.06
28 0.06
29 0.05
30 0.04
31 0.06
32 0.06
33 0.08
34 0.09
35 0.09
36 0.09
37 0.1
38 0.12
39 0.11
40 0.13
41 0.13
42 0.13
43 0.13
44 0.12
45 0.12
46 0.1
47 0.09
48 0.07
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.06
56 0.07
57 0.08
58 0.09
59 0.09
60 0.09
61 0.14
62 0.15
63 0.17
64 0.16
65 0.17
66 0.17
67 0.17
68 0.17
69 0.13
70 0.13
71 0.11
72 0.13
73 0.12
74 0.12
75 0.12
76 0.12
77 0.14
78 0.12
79 0.13
80 0.17
81 0.16
82 0.16
83 0.16
84 0.16
85 0.14
86 0.16
87 0.14
88 0.09
89 0.08
90 0.07
91 0.07
92 0.06
93 0.07
94 0.05
95 0.04
96 0.05
97 0.05
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.05
110 0.05
111 0.07
112 0.07
113 0.08
114 0.11
115 0.1
116 0.1
117 0.14
118 0.16
119 0.18
120 0.21
121 0.23
122 0.22
123 0.24
124 0.25
125 0.26
126 0.29
127 0.31
128 0.29
129 0.34
130 0.35
131 0.35
132 0.34
133 0.32
134 0.3
135 0.3
136 0.37
137 0.38
138 0.43
139 0.49
140 0.54
141 0.54
142 0.56
143 0.52
144 0.45
145 0.38
146 0.3
147 0.23
148 0.21
149 0.21
150 0.22
151 0.23
152 0.26
153 0.25
154 0.27
155 0.31
156 0.31
157 0.32
158 0.33
159 0.31
160 0.31
161 0.33
162 0.31
163 0.27
164 0.23
165 0.21
166 0.14
167 0.13
168 0.12
169 0.11
170 0.14
171 0.15
172 0.16
173 0.17
174 0.21
175 0.24
176 0.29
177 0.3
178 0.31
179 0.3
180 0.35
181 0.33
182 0.29
183 0.24
184 0.18
185 0.16
186 0.12
187 0.11
188 0.07
189 0.06
190 0.06
191 0.06
192 0.05
193 0.04
194 0.03
195 0.04
196 0.03
197 0.03
198 0.03
199 0.04
200 0.04
201 0.04
202 0.05
203 0.05
204 0.06
205 0.06
206 0.08
207 0.1
208 0.09
209 0.1
210 0.13
211 0.12
212 0.11
213 0.12
214 0.13
215 0.12
216 0.12
217 0.14
218 0.11
219 0.11
220 0.11
221 0.11
222 0.09
223 0.08
224 0.07
225 0.05
226 0.05
227 0.05
228 0.05
229 0.05
230 0.04
231 0.03
232 0.03
233 0.03
234 0.03
235 0.03
236 0.03
237 0.04
238 0.06
239 0.08
240 0.1
241 0.11
242 0.14
243 0.19
244 0.29
245 0.33
246 0.33
247 0.34
248 0.34
249 0.35
250 0.36
251 0.34
252 0.29
253 0.29
254 0.36
255 0.36
256 0.39
257 0.38
258 0.39
259 0.39
260 0.37
261 0.36
262 0.32
263 0.41
264 0.4
265 0.48
266 0.51
267 0.51
268 0.59
269 0.56
270 0.56
271 0.51
272 0.53
273 0.51
274 0.5
275 0.57
276 0.56
277 0.64
278 0.67
279 0.69
280 0.66
281 0.66
282 0.69
283 0.69
284 0.7
285 0.65
286 0.6
287 0.54
288 0.5
289 0.48
290 0.43
291 0.33
292 0.24
293 0.19
294 0.16
295 0.16
296 0.14
297 0.11
298 0.08
299 0.08
300 0.08
301 0.09
302 0.09
303 0.08
304 0.09
305 0.09
306 0.1
307 0.1
308 0.15
309 0.14
310 0.15
311 0.16
312 0.18
313 0.19
314 0.2
315 0.18
316 0.16
317 0.22
318 0.26
319 0.29
320 0.29
321 0.36
322 0.35
323 0.38
324 0.36
325 0.32
326 0.3
327 0.29
328 0.32
329 0.25
330 0.27
331 0.28
332 0.36
333 0.34
334 0.29
335 0.27
336 0.24
337 0.25
338 0.22
339 0.18
340 0.13
341 0.13
342 0.16
343 0.16
344 0.14
345 0.11
346 0.12
347 0.11
348 0.09
349 0.16
350 0.2
351 0.28
352 0.32
353 0.37
354 0.41
355 0.48
356 0.52
357 0.55
358 0.59
359 0.61
360 0.66
361 0.7
362 0.76
363 0.78
364 0.8
365 0.73
366 0.65
367 0.61
368 0.57
369 0.54
370 0.47
371 0.4
372 0.4
373 0.41
374 0.39
375 0.34
376 0.33
377 0.28
378 0.26
379 0.28
380 0.3
381 0.32
382 0.34
383 0.41
384 0.45
385 0.52
386 0.53
387 0.55
388 0.55
389 0.58
390 0.62
391 0.57
392 0.61
393 0.64
394 0.71
395 0.69
396 0.65
397 0.61
398 0.56
399 0.55
400 0.46
401 0.4
402 0.32
403 0.31
404 0.32
405 0.27
406 0.25
407 0.23
408 0.25
409 0.21
410 0.22
411 0.26
412 0.24
413 0.31
414 0.37
415 0.47
416 0.5
417 0.55
418 0.57
419 0.55
420 0.62
421 0.63
422 0.64
423 0.58
424 0.55
425 0.53
426 0.56
427 0.54
428 0.48
429 0.43
430 0.43
431 0.46
432 0.53
433 0.57
434 0.61
435 0.62
436 0.61
437 0.62
438 0.59
439 0.57
440 0.51
441 0.52
442 0.45
443 0.45
444 0.42
445 0.39
446 0.34
447 0.34
448 0.31
449 0.25
450 0.23
451 0.2
452 0.22
453 0.24
454 0.25
455 0.28
456 0.3
457 0.32
458 0.33
459 0.32
460 0.34
461 0.37
462 0.36
463 0.33
464 0.3
465 0.24
466 0.21
467 0.21
468 0.16
469 0.13
470 0.11
471 0.07
472 0.07
473 0.07
474 0.07
475 0.07
476 0.07