Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8DZY8

Protein Details
Accession A0A1B8DZY8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
81-106GSPSPPPTPKEKPLRTKRGRRAPDFLHydrophilic
NLS Segment(s)
PositionSequence
89-101PKEKPLRTKRGRR
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
Amino Acid Sequences MVLLPENAVSPPALSPSVEEAYRRKCIQLRHRIKCVEVANDASRIRLLRMRRGIEKMRLERAFLLEQLAKRTSTNVEDSDGSPSPPPTPKEKPLRTKRGRRAPDFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.16
4 0.18
5 0.18
6 0.2
7 0.23
8 0.28
9 0.34
10 0.33
11 0.32
12 0.33
13 0.42
14 0.5
15 0.56
16 0.61
17 0.63
18 0.7
19 0.68
20 0.65
21 0.63
22 0.55
23 0.48
24 0.39
25 0.35
26 0.29
27 0.31
28 0.3
29 0.23
30 0.2
31 0.17
32 0.16
33 0.16
34 0.17
35 0.21
36 0.27
37 0.3
38 0.32
39 0.38
40 0.4
41 0.43
42 0.49
43 0.44
44 0.46
45 0.43
46 0.41
47 0.36
48 0.36
49 0.29
50 0.22
51 0.21
52 0.16
53 0.16
54 0.19
55 0.19
56 0.17
57 0.16
58 0.17
59 0.17
60 0.17
61 0.2
62 0.18
63 0.19
64 0.2
65 0.21
66 0.24
67 0.22
68 0.2
69 0.18
70 0.18
71 0.19
72 0.23
73 0.25
74 0.28
75 0.35
76 0.44
77 0.53
78 0.62
79 0.7
80 0.75
81 0.84
82 0.86
83 0.9
84 0.91
85 0.92
86 0.92