Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8DPS2

Protein Details
Accession A0A1B8DPS2   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
2-49VAAKKHVPIVKKRTKRFNRHQSDRFMRVDPSWRKPKGIDNRVRRRFSGHydrophilic
NLS Segment(s)
PositionSequence
9-21PIVKKRTKRFNRH
33-39WRKPKGI
Subcellular Location(s) mito 19.5, mito_nucl 11.833, cyto 4.5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHVPIVKKRTKRFNRHQSDRFMRVDPSWRKPKGIDNRVRRRFSGQAVMPSIGFGSNKKTRHMMPSGHKAFLVNNVRDVDLLLMHNKTFAAEISHAVSSRKRVDIVARAKQLGVKVTNAKARVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.84
3 0.88
4 0.9
5 0.9
6 0.9
7 0.91
8 0.89
9 0.89
10 0.87
11 0.82
12 0.74
13 0.65
14 0.57
15 0.49
16 0.51
17 0.48
18 0.49
19 0.52
20 0.5
21 0.5
22 0.5
23 0.57
24 0.58
25 0.61
26 0.62
27 0.63
28 0.73
29 0.8
30 0.8
31 0.72
32 0.67
33 0.6
34 0.54
35 0.52
36 0.43
37 0.38
38 0.37
39 0.36
40 0.3
41 0.26
42 0.22
43 0.14
44 0.12
45 0.08
46 0.12
47 0.17
48 0.19
49 0.21
50 0.23
51 0.24
52 0.29
53 0.32
54 0.32
55 0.33
56 0.42
57 0.43
58 0.41
59 0.4
60 0.35
61 0.31
62 0.33
63 0.34
64 0.24
65 0.24
66 0.25
67 0.25
68 0.24
69 0.24
70 0.16
71 0.1
72 0.1
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.08
80 0.07
81 0.09
82 0.09
83 0.11
84 0.13
85 0.14
86 0.14
87 0.15
88 0.17
89 0.19
90 0.22
91 0.23
92 0.21
93 0.22
94 0.28
95 0.36
96 0.43
97 0.46
98 0.46
99 0.45
100 0.45
101 0.45
102 0.42
103 0.38
104 0.32
105 0.28
106 0.31
107 0.35
108 0.41
109 0.4
110 0.39
111 0.36