Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JXP3

Protein Details
Accession I2JXP3    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
88-134KSDDKDKKDEKEKEKKDKSEKSEKSDDKQKKNKKEKNSKKDNKDNNRBasic
NLS Segment(s)
PositionSequence
93-132KDKKDEKEKEKKDKSEKSEKSDDKQKKNKKEKNSKKDNKD
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016487  Lsm6/sSmF  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0120114  C:Sm-like protein family complex  
GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
Amino Acid Sequences MNFQPINPKPFLQSLLNKQVIVKLKFNSIEYHGKLLSIDNYMNLLMDKDVKEVNGKTREVSPLGDEMFIRCNNVLWICEDNEEXEKSEKSDDKDKKDEKEKEKKDKSEKSEKSDDKQKKNKKEKNSKKDNKDNNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.5
3 0.52
4 0.48
5 0.45
6 0.47
7 0.49
8 0.45
9 0.41
10 0.33
11 0.36
12 0.38
13 0.39
14 0.35
15 0.32
16 0.36
17 0.34
18 0.35
19 0.3
20 0.28
21 0.27
22 0.25
23 0.21
24 0.15
25 0.14
26 0.1
27 0.11
28 0.11
29 0.11
30 0.09
31 0.08
32 0.06
33 0.09
34 0.09
35 0.09
36 0.09
37 0.1
38 0.13
39 0.14
40 0.21
41 0.23
42 0.23
43 0.23
44 0.24
45 0.26
46 0.24
47 0.23
48 0.17
49 0.14
50 0.14
51 0.14
52 0.11
53 0.1
54 0.12
55 0.11
56 0.11
57 0.09
58 0.09
59 0.09
60 0.1
61 0.1
62 0.09
63 0.1
64 0.1
65 0.12
66 0.12
67 0.12
68 0.13
69 0.14
70 0.13
71 0.12
72 0.13
73 0.14
74 0.15
75 0.16
76 0.25
77 0.3
78 0.35
79 0.45
80 0.48
81 0.54
82 0.62
83 0.69
84 0.7
85 0.74
86 0.77
87 0.79
88 0.83
89 0.85
90 0.85
91 0.86
92 0.84
93 0.84
94 0.81
95 0.78
96 0.79
97 0.75
98 0.72
99 0.73
100 0.75
101 0.74
102 0.78
103 0.81
104 0.81
105 0.87
106 0.88
107 0.89
108 0.91
109 0.92
110 0.92
111 0.93
112 0.93
113 0.93
114 0.95