Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JVF9

Protein Details
Accession I2JVF9   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-42APNATPRPSSARRRKRLSLLPNNVTIHydrophilic
NLS Segment(s)
PositionSequence
437-444SKXKKRIK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005550  Kinetochore_Ndc80  
IPR038273  Ndc80_sf  
Gene Ontology GO:0031262  C:Ndc80 complex  
GO:0005634  C:nucleus  
GO:0051315  P:attachment of mitotic spindle microtubules to kinetochore  
GO:0051301  P:cell division  
Pfam View protein in Pfam  
PF03801  Ndc80_HEC  
Amino Acid Sequences MDNNFNGNDDSHRISYAPNATPRPSSARRRKRLSLLPNNVTIGAPRLMTQFSVKRRRLPTNSIPQSVPRPFRAASRLNSFDVASXSRRRITLQRMSNGQMQQMPPFYPPSSSGRFFDDTASMAPPSSSSRPKRFSTIPGSQRIPDPRLKRGDRSYQAKMQKDLFDYLTANKFDIHMKQQLTXRTLRSPTQKEFILXFQFLYKXIDPGYRFVRSSEQDIYSILKFLEYPYLGNITKSQLGAVGGTSWPTFLAMLHWIMQLVQQVENFDKIDLTSLNLVPDVESPDQAXLSDNESNNNSIVFSKKETDPVILRENSILDRLFTTFVINSYKSYLATGSTDYSEFYGDMEREYKKLTQDIAAKAAHFNTKNKELGVELSRMEXEHNXLQAKIDRMKALKIDVSKFQKYVESQEQRSQQWPTILSRAQQDIDSVKKSIAESKXKKRIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.29
3 0.33
4 0.35
5 0.37
6 0.4
7 0.42
8 0.44
9 0.47
10 0.49
11 0.5
12 0.55
13 0.59
14 0.66
15 0.73
16 0.79
17 0.84
18 0.84
19 0.86
20 0.86
21 0.86
22 0.85
23 0.8
24 0.76
25 0.69
26 0.6
27 0.5
28 0.4
29 0.32
30 0.23
31 0.18
32 0.15
33 0.15
34 0.15
35 0.16
36 0.22
37 0.25
38 0.34
39 0.44
40 0.47
41 0.54
42 0.61
43 0.7
44 0.71
45 0.72
46 0.73
47 0.74
48 0.78
49 0.73
50 0.67
51 0.61
52 0.62
53 0.61
54 0.56
55 0.48
56 0.44
57 0.41
58 0.45
59 0.48
60 0.46
61 0.44
62 0.48
63 0.48
64 0.45
65 0.46
66 0.41
67 0.35
68 0.32
69 0.3
70 0.26
71 0.27
72 0.27
73 0.28
74 0.3
75 0.32
76 0.37
77 0.43
78 0.47
79 0.48
80 0.51
81 0.53
82 0.57
83 0.54
84 0.48
85 0.42
86 0.35
87 0.32
88 0.3
89 0.27
90 0.22
91 0.25
92 0.22
93 0.19
94 0.21
95 0.24
96 0.28
97 0.29
98 0.29
99 0.3
100 0.32
101 0.31
102 0.3
103 0.25
104 0.2
105 0.19
106 0.19
107 0.14
108 0.12
109 0.11
110 0.1
111 0.14
112 0.18
113 0.25
114 0.31
115 0.4
116 0.45
117 0.48
118 0.53
119 0.52
120 0.54
121 0.54
122 0.56
123 0.54
124 0.55
125 0.56
126 0.51
127 0.53
128 0.5
129 0.46
130 0.43
131 0.41
132 0.42
133 0.49
134 0.51
135 0.52
136 0.54
137 0.6
138 0.61
139 0.63
140 0.62
141 0.6
142 0.65
143 0.61
144 0.58
145 0.52
146 0.47
147 0.42
148 0.39
149 0.32
150 0.26
151 0.23
152 0.23
153 0.24
154 0.2
155 0.18
156 0.16
157 0.16
158 0.16
159 0.19
160 0.2
161 0.21
162 0.22
163 0.26
164 0.29
165 0.35
166 0.36
167 0.35
168 0.34
169 0.33
170 0.36
171 0.38
172 0.4
173 0.37
174 0.37
175 0.36
176 0.34
177 0.32
178 0.28
179 0.29
180 0.24
181 0.2
182 0.19
183 0.18
184 0.18
185 0.15
186 0.15
187 0.1
188 0.11
189 0.15
190 0.15
191 0.17
192 0.16
193 0.17
194 0.22
195 0.22
196 0.24
197 0.24
198 0.22
199 0.21
200 0.21
201 0.21
202 0.16
203 0.16
204 0.12
205 0.08
206 0.07
207 0.07
208 0.1
209 0.08
210 0.08
211 0.08
212 0.12
213 0.12
214 0.13
215 0.13
216 0.12
217 0.13
218 0.13
219 0.12
220 0.09
221 0.09
222 0.09
223 0.08
224 0.07
225 0.05
226 0.06
227 0.06
228 0.05
229 0.05
230 0.05
231 0.05
232 0.04
233 0.05
234 0.06
235 0.07
236 0.08
237 0.08
238 0.08
239 0.08
240 0.09
241 0.1
242 0.09
243 0.1
244 0.09
245 0.1
246 0.11
247 0.13
248 0.12
249 0.1
250 0.09
251 0.08
252 0.09
253 0.08
254 0.08
255 0.09
256 0.09
257 0.09
258 0.09
259 0.09
260 0.09
261 0.09
262 0.13
263 0.11
264 0.1
265 0.11
266 0.11
267 0.11
268 0.11
269 0.1
270 0.09
271 0.11
272 0.12
273 0.13
274 0.14
275 0.14
276 0.14
277 0.14
278 0.11
279 0.1
280 0.11
281 0.11
282 0.13
283 0.16
284 0.17
285 0.21
286 0.22
287 0.24
288 0.25
289 0.27
290 0.32
291 0.29
292 0.28
293 0.25
294 0.25
295 0.22
296 0.22
297 0.17
298 0.11
299 0.12
300 0.12
301 0.13
302 0.11
303 0.12
304 0.1
305 0.12
306 0.16
307 0.15
308 0.15
309 0.17
310 0.17
311 0.16
312 0.16
313 0.15
314 0.12
315 0.13
316 0.14
317 0.12
318 0.13
319 0.13
320 0.13
321 0.13
322 0.12
323 0.1
324 0.09
325 0.11
326 0.1
327 0.12
328 0.15
329 0.16
330 0.16
331 0.19
332 0.21
333 0.21
334 0.24
335 0.24
336 0.27
337 0.32
338 0.34
339 0.36
340 0.35
341 0.32
342 0.31
343 0.31
344 0.32
345 0.28
346 0.31
347 0.32
348 0.38
349 0.39
350 0.38
351 0.36
352 0.31
353 0.33
354 0.32
355 0.27
356 0.21
357 0.22
358 0.23
359 0.22
360 0.24
361 0.21
362 0.19
363 0.24
364 0.25
365 0.23
366 0.24
367 0.29
368 0.31
369 0.32
370 0.35
371 0.29
372 0.32
373 0.34
374 0.36
375 0.35
376 0.36
377 0.37
378 0.4
379 0.46
380 0.47
381 0.45
382 0.43
383 0.44
384 0.4
385 0.45
386 0.47
387 0.47
388 0.48
389 0.55
390 0.6
391 0.57
392 0.6
393 0.56
394 0.49
395 0.46
396 0.45
397 0.42
398 0.43
399 0.43
400 0.41
401 0.43
402 0.43
403 0.39
404 0.36
405 0.34
406 0.32
407 0.35
408 0.35
409 0.3
410 0.26
411 0.28
412 0.29
413 0.35
414 0.4
415 0.45
416 0.51