Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JUR6

Protein Details
Accession I2JUR6    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
61-86KIIIKALKPIKKKKIKKEIKILQDLAHydrophilic
NLS Segment(s)
PositionSequence
65-78KALKPIKKKKIKKE
Subcellular Location(s) cyto 22.5, cyto_nucl 13.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045216  CK2_alpha  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR017441  Protein_kinase_ATP_BS  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0006468  P:protein phosphorylation  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS00107  PROTEIN_KINASE_ATP  
PS50011  PROTEIN_KINASE_DOM  
Amino Acid Sequences MVVSISRVYADVNEHKPKSYWDYENLSISWGTQKNYEVTRKVGRGKYSEVFEGCEMGTGNKIIIKALKPIKKKKIKKEIKILQDLAGGPQIVELLDVVRDPISKNXGTDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.39
4 0.42
5 0.43
6 0.43
7 0.39
8 0.36
9 0.42
10 0.44
11 0.45
12 0.41
13 0.35
14 0.28
15 0.24
16 0.25
17 0.2
18 0.19
19 0.18
20 0.19
21 0.21
22 0.26
23 0.31
24 0.26
25 0.29
26 0.33
27 0.36
28 0.41
29 0.42
30 0.4
31 0.38
32 0.41
33 0.39
34 0.36
35 0.34
36 0.27
37 0.25
38 0.21
39 0.19
40 0.14
41 0.11
42 0.09
43 0.07
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.08
51 0.09
52 0.15
53 0.23
54 0.29
55 0.36
56 0.45
57 0.56
58 0.64
59 0.72
60 0.76
61 0.8
62 0.84
63 0.86
64 0.88
65 0.86
66 0.84
67 0.84
68 0.74
69 0.65
70 0.57
71 0.48
72 0.38
73 0.32
74 0.22
75 0.14
76 0.12
77 0.11
78 0.07
79 0.07
80 0.06
81 0.04
82 0.05
83 0.05
84 0.06
85 0.07
86 0.08
87 0.09
88 0.15
89 0.18