Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8DM62

Protein Details
Accession A0A1B8DM62   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
36-65LKEDRVVRKGRKKEKEEKKGKEKEKEKDVVBasic
NLS Segment(s)
PositionSequence
42-61VRKGRKKEKEEKKGKEKEKE
Subcellular Location(s) mito 12.5, mito_nucl 11.166, nucl 8.5, cyto_nucl 7.833, cyto 5
Family & Domain DBs
Amino Acid Sequences MLAFIATLKLPLARLCSPTLFVSSKSSLKEDIYSNLKEDRVVRKGRKKEKEEKKGKEKEKEKDVVVLLPLVATKVTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.22
4 0.24
5 0.24
6 0.26
7 0.22
8 0.21
9 0.23
10 0.24
11 0.26
12 0.25
13 0.25
14 0.23
15 0.22
16 0.23
17 0.2
18 0.21
19 0.23
20 0.22
21 0.22
22 0.22
23 0.21
24 0.2
25 0.22
26 0.23
27 0.24
28 0.31
29 0.37
30 0.44
31 0.54
32 0.63
33 0.7
34 0.72
35 0.77
36 0.81
37 0.84
38 0.86
39 0.86
40 0.87
41 0.87
42 0.88
43 0.87
44 0.85
45 0.83
46 0.81
47 0.77
48 0.68
49 0.63
50 0.56
51 0.48
52 0.4
53 0.32
54 0.23
55 0.18
56 0.16
57 0.11