Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JSA4

Protein Details
Accession I2JSA4    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
60-92DQTTQARRRRKIIRKKAERKKFEEKKKKMFEEEBasic
NLS Segment(s)
PositionSequence
69-90RRRRKIIRKKAERKKFEEKKKK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MXSSEKKXPKQDDSQLFPEVDENNFMACSSLMRALXECQKKGFINKALGRCSSLRQELNMCLDQTTQARRRRKIIRKKAERKKFEEKKKKMFEEEYGKDGYLKKVIEKEYEMKHGKKPDGTPTSNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.52
3 0.45
4 0.36
5 0.29
6 0.24
7 0.16
8 0.13
9 0.13
10 0.13
11 0.1
12 0.09
13 0.09
14 0.08
15 0.11
16 0.11
17 0.12
18 0.14
19 0.2
20 0.28
21 0.29
22 0.28
23 0.27
24 0.31
25 0.33
26 0.37
27 0.35
28 0.36
29 0.4
30 0.44
31 0.45
32 0.41
33 0.41
34 0.37
35 0.34
36 0.3
37 0.29
38 0.25
39 0.23
40 0.25
41 0.24
42 0.27
43 0.26
44 0.21
45 0.16
46 0.16
47 0.16
48 0.15
49 0.19
50 0.23
51 0.29
52 0.36
53 0.38
54 0.46
55 0.56
56 0.64
57 0.7
58 0.73
59 0.77
60 0.81
61 0.89
62 0.92
63 0.92
64 0.9
65 0.86
66 0.86
67 0.85
68 0.85
69 0.86
70 0.84
71 0.84
72 0.86
73 0.83
74 0.78
75 0.72
76 0.69
77 0.68
78 0.62
79 0.54
80 0.46
81 0.41
82 0.37
83 0.35
84 0.29
85 0.24
86 0.21
87 0.22
88 0.27
89 0.29
90 0.31
91 0.34
92 0.38
93 0.38
94 0.47
95 0.5
96 0.47
97 0.51
98 0.55
99 0.55
100 0.55
101 0.55
102 0.56
103 0.59