Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2JRF0

Protein Details
Accession I2JRF0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-34TSYSKDSKKNIKKLIEKTKEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 12.333, mito 4, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024661  RNA_pol_III_Rpc31  
Gene Ontology GO:0005634  C:nucleus  
GO:0006383  P:transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF11705  RNA_pol_3_Rpc31  
Amino Acid Sequences MTRGDKKHGSLQLTSYSKDSKKNIKKLIEKTKEEKRNEIQERLNNVEGNDSEVEKHSEEEDDDEQFEDDYDDDYNAERYFEDGDDLGGEEEDAGDDEAAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.37
3 0.37
4 0.36
5 0.41
6 0.43
7 0.45
8 0.52
9 0.61
10 0.66
11 0.69
12 0.75
13 0.78
14 0.83
15 0.82
16 0.78
17 0.75
18 0.77
19 0.77
20 0.7
21 0.68
22 0.63
23 0.64
24 0.63
25 0.62
26 0.57
27 0.53
28 0.55
29 0.52
30 0.48
31 0.38
32 0.33
33 0.29
34 0.23
35 0.2
36 0.15
37 0.11
38 0.1
39 0.1
40 0.11
41 0.1
42 0.1
43 0.08
44 0.08
45 0.09
46 0.12
47 0.12
48 0.11
49 0.11
50 0.11
51 0.11
52 0.1
53 0.1
54 0.07
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.07
61 0.09
62 0.08
63 0.09
64 0.08
65 0.08
66 0.1
67 0.1
68 0.11
69 0.09
70 0.09
71 0.09
72 0.1
73 0.09
74 0.07
75 0.07
76 0.05
77 0.05
78 0.05
79 0.06
80 0.06