Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8DTX2

Protein Details
Accession A0A1B8DTX2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
64-85NMQKTDCGWGRKRCCCKKQKSLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, mito 3, golg 3
Family & Domain DBs
Amino Acid Sequences MKLNILLLAAVVTGALAAPTADQSAPEPNVLELQERGTCWNRSSCSFSWAGKCEDYCNPWKFDNMQKTDCGWGRKRCCCKKQKSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.02
4 0.02
5 0.03
6 0.03
7 0.05
8 0.05
9 0.05
10 0.07
11 0.11
12 0.12
13 0.12
14 0.12
15 0.11
16 0.13
17 0.13
18 0.13
19 0.1
20 0.11
21 0.12
22 0.11
23 0.15
24 0.16
25 0.17
26 0.17
27 0.21
28 0.2
29 0.21
30 0.27
31 0.24
32 0.24
33 0.26
34 0.26
35 0.26
36 0.28
37 0.28
38 0.23
39 0.23
40 0.23
41 0.23
42 0.26
43 0.3
44 0.3
45 0.31
46 0.3
47 0.33
48 0.33
49 0.39
50 0.44
51 0.42
52 0.42
53 0.41
54 0.42
55 0.46
56 0.47
57 0.46
58 0.45
59 0.48
60 0.55
61 0.63
62 0.73
63 0.76
64 0.82
65 0.85