Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2K2S3

Protein Details
Accession I2K2S3    Localization Confidence High Confidence Score 20.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-43GDIKDDKKSRTKYDKMFERKNQSVHydrophilic
160-186EDKNVAKERRAEKKRRRKEIERMAKEABasic
NLS Segment(s)
PositionSequence
93-112KRAIKRATSKKLSAKLKGKG
168-181KERRAEKKRRRKEI
Subcellular Location(s) nucl 24, mito 1, cyto 1, vacu 1, cyto_mito 1
Family & Domain DBs
Gene Ontology GO:0004386  F:helicase activity  
Amino Acid Sequences MKKKKNASRKLRLLATXDENGDIKDDKKSRTKYDKMFERKNQSVLSEHYLQMTEDTAGKKDGNDDDEFLTVRRKMSEVDDEELPMLEYNATSKRAIKRATSKKLSAKLKGKGSKMVFDDSGNAHPVYELQNMKDVEKEGPVDQLKEKFLXEERNKLETADVEDKNVAKERRAEKKRRRKEIERMAKEAEEDDEVHTYVVLGNENEDNQASSAEESQSGVEDDVPDLDRDLAIGAKEEEELEEKQRKRSAEDEESEEEEKEEAEPPSKRARIPNEDEEEDDIIEMEKPEGITDLEALSEKLINE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.63
3 0.56
4 0.46
5 0.4
6 0.33
7 0.31
8 0.26
9 0.21
10 0.25
11 0.26
12 0.31
13 0.39
14 0.45
15 0.53
16 0.63
17 0.7
18 0.71
19 0.77
20 0.81
21 0.82
22 0.85
23 0.84
24 0.84
25 0.8
26 0.76
27 0.67
28 0.59
29 0.53
30 0.47
31 0.44
32 0.38
33 0.34
34 0.3
35 0.28
36 0.26
37 0.22
38 0.19
39 0.14
40 0.13
41 0.14
42 0.14
43 0.15
44 0.16
45 0.15
46 0.19
47 0.21
48 0.22
49 0.22
50 0.23
51 0.22
52 0.23
53 0.23
54 0.19
55 0.2
56 0.17
57 0.17
58 0.16
59 0.15
60 0.16
61 0.2
62 0.28
63 0.27
64 0.29
65 0.28
66 0.28
67 0.27
68 0.25
69 0.21
70 0.13
71 0.09
72 0.06
73 0.05
74 0.07
75 0.1
76 0.12
77 0.12
78 0.18
79 0.23
80 0.29
81 0.32
82 0.37
83 0.45
84 0.53
85 0.62
86 0.63
87 0.64
88 0.65
89 0.71
90 0.71
91 0.69
92 0.66
93 0.63
94 0.67
95 0.66
96 0.61
97 0.6
98 0.55
99 0.52
100 0.46
101 0.42
102 0.33
103 0.27
104 0.27
105 0.21
106 0.21
107 0.18
108 0.15
109 0.12
110 0.11
111 0.12
112 0.13
113 0.15
114 0.15
115 0.13
116 0.19
117 0.2
118 0.2
119 0.2
120 0.19
121 0.15
122 0.15
123 0.16
124 0.11
125 0.15
126 0.16
127 0.16
128 0.17
129 0.18
130 0.18
131 0.17
132 0.17
133 0.15
134 0.21
135 0.27
136 0.28
137 0.29
138 0.31
139 0.31
140 0.31
141 0.28
142 0.23
143 0.2
144 0.25
145 0.21
146 0.19
147 0.19
148 0.19
149 0.2
150 0.25
151 0.2
152 0.15
153 0.22
154 0.28
155 0.38
156 0.47
157 0.56
158 0.62
159 0.73
160 0.81
161 0.85
162 0.87
163 0.85
164 0.87
165 0.88
166 0.88
167 0.82
168 0.76
169 0.68
170 0.59
171 0.51
172 0.4
173 0.3
174 0.2
175 0.15
176 0.12
177 0.11
178 0.1
179 0.1
180 0.09
181 0.08
182 0.07
183 0.07
184 0.07
185 0.06
186 0.07
187 0.08
188 0.08
189 0.09
190 0.08
191 0.08
192 0.07
193 0.07
194 0.07
195 0.07
196 0.08
197 0.08
198 0.08
199 0.08
200 0.08
201 0.08
202 0.08
203 0.08
204 0.07
205 0.07
206 0.07
207 0.08
208 0.09
209 0.08
210 0.08
211 0.08
212 0.07
213 0.07
214 0.07
215 0.07
216 0.06
217 0.07
218 0.07
219 0.07
220 0.08
221 0.08
222 0.08
223 0.1
224 0.12
225 0.17
226 0.25
227 0.26
228 0.32
229 0.36
230 0.36
231 0.38
232 0.42
233 0.45
234 0.46
235 0.48
236 0.48
237 0.47
238 0.5
239 0.47
240 0.42
241 0.33
242 0.24
243 0.2
244 0.16
245 0.15
246 0.13
247 0.17
248 0.19
249 0.22
250 0.32
251 0.35
252 0.37
253 0.42
254 0.5
255 0.54
256 0.6
257 0.66
258 0.64
259 0.63
260 0.61
261 0.56
262 0.48
263 0.39
264 0.31
265 0.21
266 0.14
267 0.13
268 0.12
269 0.09
270 0.09
271 0.09
272 0.09
273 0.1
274 0.1
275 0.1
276 0.1
277 0.1
278 0.09
279 0.1
280 0.1
281 0.1