Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8DNQ4

Protein Details
Accession A0A1B8DNQ4   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-22ATTQTSQKPRQHFPDRPQFSGHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, mito 5, golg 4, pero 3, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004294  Carotenoid_Oase  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0016702  F:oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen  
Pfam View protein in Pfam  
PF03055  RPE65  
Amino Acid Sequences MATTQTSQKPRQHFPDRPQFSGFMKPCRVEGKILNLEVYGEIPADIDGTFYRVMPDPQFSPFIEDDPWFNGDGNISAFRIKDGQISFQQRYVRTEKFTRERDAQRALLGKYRNKFTDAVEFKVRTTANTNVVYFNGNLLALKEDSPPYALDPHTLETRGMYTFDGQLPSLTFTAHPKFDPKTGEMICFGYEAKGDGTPDVCYYRIAPDGKFLEVVWLCAPVVAMIHDFAVTDNWVLFPMIPQLCDIERMKQGGEHWEWNPDAPFYIGVIPRKGAKSTDVKWFRYQNSFPGHTANAYEDESGKIILDLGLSDKNVFFWWPDARGNAPEPSSIHSQLTRFTIDPLSSDLDLSNPSVLQSNNSEFYRIDDRFATQVYKHCFFNLMDPALGTDFAAIAPQLGGGYPLYNSLAHLDIDSRETEIYFPDSLVSVSDNLEDYVSEGSDSLVPDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.8
4 0.76
5 0.71
6 0.64
7 0.57
8 0.59
9 0.53
10 0.51
11 0.5
12 0.47
13 0.47
14 0.49
15 0.48
16 0.43
17 0.43
18 0.44
19 0.45
20 0.45
21 0.42
22 0.36
23 0.35
24 0.3
25 0.26
26 0.16
27 0.09
28 0.08
29 0.07
30 0.07
31 0.07
32 0.06
33 0.07
34 0.06
35 0.09
36 0.09
37 0.09
38 0.12
39 0.13
40 0.16
41 0.17
42 0.21
43 0.21
44 0.23
45 0.26
46 0.24
47 0.28
48 0.26
49 0.25
50 0.24
51 0.22
52 0.21
53 0.21
54 0.22
55 0.17
56 0.17
57 0.15
58 0.14
59 0.14
60 0.15
61 0.13
62 0.12
63 0.13
64 0.13
65 0.13
66 0.15
67 0.14
68 0.18
69 0.18
70 0.22
71 0.29
72 0.36
73 0.37
74 0.39
75 0.43
76 0.39
77 0.44
78 0.45
79 0.42
80 0.4
81 0.45
82 0.5
83 0.54
84 0.57
85 0.58
86 0.6
87 0.62
88 0.63
89 0.63
90 0.55
91 0.5
92 0.5
93 0.45
94 0.42
95 0.42
96 0.41
97 0.4
98 0.44
99 0.42
100 0.39
101 0.4
102 0.36
103 0.41
104 0.38
105 0.38
106 0.39
107 0.38
108 0.35
109 0.39
110 0.36
111 0.27
112 0.29
113 0.29
114 0.28
115 0.31
116 0.31
117 0.27
118 0.27
119 0.27
120 0.22
121 0.18
122 0.12
123 0.09
124 0.08
125 0.08
126 0.09
127 0.08
128 0.09
129 0.11
130 0.11
131 0.11
132 0.12
133 0.12
134 0.11
135 0.14
136 0.13
137 0.14
138 0.14
139 0.16
140 0.17
141 0.17
142 0.16
143 0.13
144 0.15
145 0.13
146 0.12
147 0.11
148 0.1
149 0.11
150 0.13
151 0.13
152 0.12
153 0.12
154 0.11
155 0.13
156 0.11
157 0.1
158 0.09
159 0.12
160 0.15
161 0.16
162 0.16
163 0.18
164 0.2
165 0.23
166 0.25
167 0.23
168 0.27
169 0.27
170 0.27
171 0.25
172 0.24
173 0.2
174 0.18
175 0.16
176 0.09
177 0.08
178 0.08
179 0.07
180 0.07
181 0.07
182 0.07
183 0.08
184 0.08
185 0.09
186 0.09
187 0.09
188 0.08
189 0.09
190 0.1
191 0.14
192 0.15
193 0.14
194 0.18
195 0.19
196 0.19
197 0.19
198 0.17
199 0.17
200 0.16
201 0.16
202 0.12
203 0.11
204 0.1
205 0.1
206 0.1
207 0.05
208 0.05
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.1
226 0.1
227 0.1
228 0.1
229 0.11
230 0.11
231 0.15
232 0.16
233 0.14
234 0.15
235 0.16
236 0.16
237 0.16
238 0.17
239 0.19
240 0.21
241 0.21
242 0.2
243 0.22
244 0.22
245 0.22
246 0.21
247 0.15
248 0.13
249 0.1
250 0.1
251 0.07
252 0.1
253 0.12
254 0.13
255 0.14
256 0.14
257 0.17
258 0.18
259 0.18
260 0.16
261 0.18
262 0.23
263 0.26
264 0.35
265 0.39
266 0.41
267 0.46
268 0.51
269 0.49
270 0.5
271 0.48
272 0.44
273 0.45
274 0.45
275 0.4
276 0.37
277 0.34
278 0.27
279 0.27
280 0.21
281 0.17
282 0.14
283 0.14
284 0.12
285 0.12
286 0.12
287 0.11
288 0.09
289 0.07
290 0.06
291 0.06
292 0.05
293 0.05
294 0.06
295 0.07
296 0.07
297 0.08
298 0.08
299 0.08
300 0.09
301 0.09
302 0.08
303 0.1
304 0.12
305 0.15
306 0.17
307 0.18
308 0.2
309 0.22
310 0.24
311 0.24
312 0.22
313 0.2
314 0.2
315 0.22
316 0.25
317 0.24
318 0.23
319 0.23
320 0.23
321 0.24
322 0.25
323 0.24
324 0.2
325 0.2
326 0.21
327 0.19
328 0.19
329 0.19
330 0.19
331 0.17
332 0.17
333 0.14
334 0.13
335 0.14
336 0.13
337 0.11
338 0.08
339 0.08
340 0.11
341 0.11
342 0.13
343 0.16
344 0.19
345 0.23
346 0.23
347 0.24
348 0.22
349 0.26
350 0.32
351 0.28
352 0.26
353 0.23
354 0.25
355 0.25
356 0.27
357 0.26
358 0.2
359 0.27
360 0.31
361 0.33
362 0.32
363 0.3
364 0.32
365 0.3
366 0.34
367 0.34
368 0.29
369 0.26
370 0.26
371 0.26
372 0.23
373 0.23
374 0.16
375 0.09
376 0.07
377 0.06
378 0.07
379 0.05
380 0.05
381 0.05
382 0.05
383 0.05
384 0.04
385 0.06
386 0.06
387 0.06
388 0.06
389 0.08
390 0.09
391 0.09
392 0.1
393 0.11
394 0.13
395 0.12
396 0.13
397 0.13
398 0.13
399 0.15
400 0.15
401 0.14
402 0.13
403 0.13
404 0.13
405 0.13
406 0.16
407 0.14
408 0.13
409 0.13
410 0.13
411 0.13
412 0.13
413 0.13
414 0.1
415 0.11
416 0.12
417 0.12
418 0.12
419 0.12
420 0.11
421 0.1
422 0.11
423 0.1
424 0.09
425 0.08
426 0.09
427 0.11