Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8ECS4

Protein Details
Accession A0A1B8ECS4    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
42-65LPSPPCPSRPSKKQYLRLFPQQRAHydrophilic
NLS Segment(s)
PositionSequence
319-322RRKS
333-342GRSEKGVKGG
Subcellular Location(s) nucl 9, cyto 7, mito_nucl 7, mito 5, extr 5
Family & Domain DBs
Amino Acid Sequences MSPCRLCAAPFPPVIVRGVDAPALPALPDFEDKWPNFLDSPLPSPPCPSRPSKKQYLRLFPQQRAMPPTPPSSPRRLKPANSDNTITAYDLHALSPLSPMENLFIVTPSSDTSSLSDPSVYSPSDEDDDYEFSGFPSWHNSYDFPATPSASPTDLSPLYRCNSPSKFAFDIASLGSPTIPPRSSSRNSNRTTNSRRQPAPRPQAGPPLHFSGPRRAPPLEAPAFRHHATPPLPAPGLPEFAPKAASPPRRPSSYSANVTPSSPSLPTPSPLARAMPLSSSPPLAEKSVFDHEDEGVKGLKGVKARFHGRGVSSGAQGVRRKSAGEIVKGIFGGRSEKGVKGGKGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.27
3 0.23
4 0.18
5 0.19
6 0.16
7 0.14
8 0.14
9 0.13
10 0.12
11 0.11
12 0.09
13 0.09
14 0.1
15 0.13
16 0.14
17 0.18
18 0.26
19 0.26
20 0.3
21 0.3
22 0.3
23 0.28
24 0.27
25 0.27
26 0.22
27 0.27
28 0.3
29 0.32
30 0.3
31 0.35
32 0.39
33 0.39
34 0.41
35 0.45
36 0.48
37 0.55
38 0.63
39 0.69
40 0.74
41 0.78
42 0.84
43 0.85
44 0.83
45 0.84
46 0.84
47 0.77
48 0.75
49 0.69
50 0.64
51 0.62
52 0.57
53 0.51
54 0.47
55 0.48
56 0.45
57 0.47
58 0.48
59 0.49
60 0.54
61 0.53
62 0.58
63 0.61
64 0.6
65 0.64
66 0.7
67 0.68
68 0.64
69 0.63
70 0.54
71 0.5
72 0.46
73 0.36
74 0.26
75 0.18
76 0.16
77 0.13
78 0.12
79 0.1
80 0.09
81 0.09
82 0.1
83 0.09
84 0.08
85 0.08
86 0.08
87 0.08
88 0.09
89 0.09
90 0.07
91 0.08
92 0.07
93 0.07
94 0.07
95 0.07
96 0.09
97 0.09
98 0.09
99 0.1
100 0.12
101 0.13
102 0.13
103 0.13
104 0.11
105 0.12
106 0.14
107 0.12
108 0.11
109 0.1
110 0.11
111 0.12
112 0.12
113 0.12
114 0.11
115 0.12
116 0.12
117 0.12
118 0.1
119 0.09
120 0.1
121 0.09
122 0.08
123 0.12
124 0.13
125 0.15
126 0.16
127 0.17
128 0.18
129 0.22
130 0.22
131 0.17
132 0.17
133 0.17
134 0.15
135 0.16
136 0.15
137 0.12
138 0.11
139 0.1
140 0.12
141 0.12
142 0.13
143 0.12
144 0.14
145 0.15
146 0.17
147 0.18
148 0.21
149 0.22
150 0.24
151 0.25
152 0.27
153 0.27
154 0.26
155 0.25
156 0.19
157 0.18
158 0.15
159 0.14
160 0.08
161 0.07
162 0.06
163 0.06
164 0.06
165 0.08
166 0.08
167 0.09
168 0.12
169 0.19
170 0.22
171 0.31
172 0.4
173 0.47
174 0.49
175 0.55
176 0.57
177 0.59
178 0.64
179 0.64
180 0.63
181 0.61
182 0.63
183 0.62
184 0.67
185 0.68
186 0.69
187 0.66
188 0.62
189 0.57
190 0.62
191 0.58
192 0.51
193 0.43
194 0.39
195 0.34
196 0.33
197 0.33
198 0.32
199 0.36
200 0.37
201 0.37
202 0.33
203 0.34
204 0.34
205 0.4
206 0.37
207 0.33
208 0.34
209 0.35
210 0.39
211 0.37
212 0.36
213 0.28
214 0.28
215 0.28
216 0.28
217 0.25
218 0.24
219 0.24
220 0.22
221 0.25
222 0.21
223 0.22
224 0.18
225 0.19
226 0.16
227 0.16
228 0.17
229 0.14
230 0.17
231 0.23
232 0.31
233 0.34
234 0.43
235 0.48
236 0.5
237 0.53
238 0.52
239 0.54
240 0.55
241 0.54
242 0.48
243 0.48
244 0.45
245 0.43
246 0.4
247 0.31
248 0.24
249 0.2
250 0.17
251 0.17
252 0.18
253 0.18
254 0.22
255 0.22
256 0.23
257 0.24
258 0.25
259 0.21
260 0.22
261 0.22
262 0.19
263 0.19
264 0.19
265 0.19
266 0.18
267 0.17
268 0.17
269 0.18
270 0.18
271 0.17
272 0.15
273 0.19
274 0.25
275 0.26
276 0.24
277 0.24
278 0.23
279 0.25
280 0.25
281 0.21
282 0.15
283 0.14
284 0.15
285 0.16
286 0.18
287 0.2
288 0.22
289 0.27
290 0.33
291 0.39
292 0.42
293 0.44
294 0.47
295 0.43
296 0.45
297 0.44
298 0.39
299 0.35
300 0.33
301 0.32
302 0.33
303 0.35
304 0.34
305 0.33
306 0.31
307 0.31
308 0.3
309 0.36
310 0.36
311 0.36
312 0.39
313 0.35
314 0.36
315 0.35
316 0.34
317 0.26
318 0.21
319 0.2
320 0.16
321 0.2
322 0.21
323 0.22
324 0.29
325 0.35