Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8DVM6

Protein Details
Accession A0A1B8DVM6    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
124-172YSNSEKDRAARKGRKKEKEEKKGKEKEKEKEKEKEKEKDAGRTRPRRRSBasic
NLS Segment(s)
PositionSequence
130-172DRAARKGRKKEKEEKKGKEKEKEKEKEKEKEKDAGRTRPRRRS
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MAGSDSTLPVVNDSDTNSVTPRASTPVPAFAATLNPSSAPSSLVAVPMVAVVSPTTPTAPSMASATLPVVVPVVPVASSLAALASPVLSPASPASSRHGPVVSSLTGSPTLFVSSKSSLEEDMYSNSEKDRAARKGRKKEKEEKKGKEKEKEKEKEKEKEKDAGRTRPRRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.16
4 0.17
5 0.18
6 0.17
7 0.17
8 0.16
9 0.18
10 0.17
11 0.21
12 0.21
13 0.25
14 0.26
15 0.25
16 0.24
17 0.2
18 0.22
19 0.2
20 0.19
21 0.14
22 0.12
23 0.13
24 0.14
25 0.14
26 0.12
27 0.1
28 0.11
29 0.11
30 0.12
31 0.11
32 0.09
33 0.09
34 0.08
35 0.07
36 0.04
37 0.04
38 0.03
39 0.04
40 0.05
41 0.05
42 0.06
43 0.06
44 0.07
45 0.07
46 0.08
47 0.08
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.07
54 0.07
55 0.06
56 0.05
57 0.05
58 0.05
59 0.04
60 0.04
61 0.03
62 0.03
63 0.04
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.02
73 0.03
74 0.03
75 0.03
76 0.03
77 0.04
78 0.06
79 0.07
80 0.08
81 0.12
82 0.15
83 0.16
84 0.18
85 0.18
86 0.15
87 0.16
88 0.18
89 0.14
90 0.12
91 0.11
92 0.11
93 0.12
94 0.12
95 0.11
96 0.08
97 0.09
98 0.09
99 0.1
100 0.12
101 0.13
102 0.14
103 0.14
104 0.15
105 0.14
106 0.15
107 0.15
108 0.13
109 0.13
110 0.15
111 0.15
112 0.14
113 0.14
114 0.15
115 0.14
116 0.17
117 0.23
118 0.28
119 0.38
120 0.48
121 0.57
122 0.67
123 0.77
124 0.83
125 0.84
126 0.87
127 0.88
128 0.89
129 0.9
130 0.89
131 0.9
132 0.9
133 0.9
134 0.9
135 0.88
136 0.87
137 0.87
138 0.87
139 0.84
140 0.84
141 0.85
142 0.84
143 0.85
144 0.84
145 0.79
146 0.78
147 0.74
148 0.75
149 0.74
150 0.75
151 0.76
152 0.77