Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2K1W1

Protein Details
Accession I2K1W1   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKKRASNGRNKKGRGHVKPVRCVNCHydrophilic
81-112ARIVRVRSREGRKVRRPPVRRRYNAEKRVNPABasic
NLS Segment(s)
PositionSequence
3-18KKRASNGRNKKGRGHV
85-108RVRSREGRKVRRPPVRRRYNAEKR
Subcellular Location(s) mito 14.5, mito_nucl 12, nucl 8.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRASNGRNKKGRGHVKPVRCVNCSRCVPKDKAIKRMSIRNMVEAAAVRDLSEASVYDEYPIPKMYNKLHYCVSCAIHARIVRVRSREGRKVRRPPVRRRYNAEKRVNPAAAATRAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.77
5 0.76
6 0.81
7 0.82
8 0.78
9 0.7
10 0.69
11 0.63
12 0.64
13 0.62
14 0.59
15 0.56
16 0.57
17 0.58
18 0.59
19 0.65
20 0.61
21 0.63
22 0.61
23 0.61
24 0.59
25 0.63
26 0.6
27 0.59
28 0.54
29 0.46
30 0.44
31 0.36
32 0.33
33 0.24
34 0.2
35 0.12
36 0.11
37 0.08
38 0.07
39 0.07
40 0.06
41 0.06
42 0.05
43 0.06
44 0.06
45 0.06
46 0.07
47 0.09
48 0.09
49 0.09
50 0.1
51 0.09
52 0.1
53 0.13
54 0.16
55 0.24
56 0.25
57 0.27
58 0.31
59 0.31
60 0.32
61 0.32
62 0.31
63 0.24
64 0.25
65 0.23
66 0.23
67 0.24
68 0.24
69 0.25
70 0.27
71 0.29
72 0.29
73 0.34
74 0.39
75 0.45
76 0.52
77 0.58
78 0.65
79 0.71
80 0.79
81 0.83
82 0.85
83 0.87
84 0.88
85 0.89
86 0.9
87 0.87
88 0.85
89 0.87
90 0.87
91 0.88
92 0.88
93 0.84
94 0.79
95 0.8
96 0.72
97 0.61
98 0.54
99 0.5