Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8ED54

Protein Details
Accession A0A1B8ED54    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-28TSSFRKAWLKWKSMRLPWRKRFLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007763  NDUFA12  
Gene Ontology GO:0016020  C:membrane  
GO:0032981  P:mitochondrial respiratory chain complex I assembly  
Pfam View protein in Pfam  
PF05071  NDUFA12  
Amino Acid Sequences MSTPTSSFRKAWLKWKSMRLPWRKRFLVGLDLQGNTYWEFRDTLSPGRMRRIVDYPPHVQYSDVSSHITPAWHQWLRHTRKAAPTLAEQELDLRRQRRVKILAAQADERWEAKGRLVGGPSMRQTRPGLGMGNTAATGQPETETGTAGMAADAEGPTRRGDVATEGKQESKAAERTTTSTVSSGQEILDRESERMKVSGGPGPKVYTNPGVSGKDNTARREPATPPPRKEDPWKNARGGPSEDWQPQAWSPGQATRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.74
3 0.75
4 0.75
5 0.81
6 0.82
7 0.84
8 0.84
9 0.86
10 0.79
11 0.72
12 0.69
13 0.62
14 0.6
15 0.52
16 0.5
17 0.44
18 0.41
19 0.39
20 0.34
21 0.31
22 0.23
23 0.2
24 0.14
25 0.11
26 0.11
27 0.12
28 0.17
29 0.18
30 0.23
31 0.28
32 0.33
33 0.34
34 0.39
35 0.42
36 0.38
37 0.4
38 0.39
39 0.39
40 0.41
41 0.45
42 0.43
43 0.43
44 0.44
45 0.4
46 0.36
47 0.3
48 0.28
49 0.25
50 0.21
51 0.19
52 0.17
53 0.18
54 0.19
55 0.18
56 0.13
57 0.14
58 0.22
59 0.23
60 0.23
61 0.3
62 0.4
63 0.47
64 0.53
65 0.54
66 0.5
67 0.54
68 0.59
69 0.54
70 0.46
71 0.43
72 0.41
73 0.38
74 0.34
75 0.26
76 0.25
77 0.23
78 0.23
79 0.24
80 0.21
81 0.25
82 0.29
83 0.31
84 0.35
85 0.38
86 0.39
87 0.43
88 0.48
89 0.47
90 0.45
91 0.44
92 0.36
93 0.34
94 0.29
95 0.22
96 0.17
97 0.14
98 0.12
99 0.11
100 0.13
101 0.12
102 0.13
103 0.13
104 0.13
105 0.13
106 0.15
107 0.17
108 0.2
109 0.19
110 0.2
111 0.2
112 0.2
113 0.21
114 0.2
115 0.18
116 0.14
117 0.15
118 0.12
119 0.12
120 0.1
121 0.08
122 0.07
123 0.06
124 0.05
125 0.04
126 0.04
127 0.04
128 0.06
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.05
136 0.04
137 0.03
138 0.03
139 0.03
140 0.04
141 0.04
142 0.05
143 0.06
144 0.06
145 0.06
146 0.06
147 0.07
148 0.11
149 0.18
150 0.2
151 0.24
152 0.24
153 0.25
154 0.25
155 0.25
156 0.21
157 0.19
158 0.2
159 0.18
160 0.19
161 0.19
162 0.22
163 0.25
164 0.25
165 0.21
166 0.18
167 0.18
168 0.18
169 0.17
170 0.15
171 0.12
172 0.13
173 0.13
174 0.14
175 0.16
176 0.16
177 0.16
178 0.18
179 0.19
180 0.17
181 0.17
182 0.16
183 0.14
184 0.16
185 0.2
186 0.21
187 0.22
188 0.22
189 0.24
190 0.25
191 0.24
192 0.25
193 0.26
194 0.25
195 0.26
196 0.29
197 0.3
198 0.3
199 0.32
200 0.32
201 0.34
202 0.37
203 0.38
204 0.39
205 0.4
206 0.4
207 0.42
208 0.42
209 0.45
210 0.52
211 0.56
212 0.55
213 0.59
214 0.63
215 0.64
216 0.7
217 0.7
218 0.7
219 0.71
220 0.73
221 0.7
222 0.68
223 0.68
224 0.63
225 0.59
226 0.53
227 0.48
228 0.48
229 0.46
230 0.44
231 0.4
232 0.38
233 0.33
234 0.33
235 0.3
236 0.26
237 0.26