Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2JVB3

Protein Details
Accession I2JVB3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MLNKRIRYRSKEYLRERRKEIIKBasic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
Amino Acid Sequences MLNKRIRYRSKEYXLRERRKEIIKDLTNENDAETRSQLSLKKDKVRKEFLELNRKKRSVLNSIREENSGLKKYNVGDFNLYKFSATRTSIDXTEKSEXVGSKPRNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.82
4 0.8
5 0.78
6 0.73
7 0.69
8 0.69
9 0.64
10 0.6
11 0.6
12 0.54
13 0.48
14 0.43
15 0.36
16 0.28
17 0.23
18 0.2
19 0.16
20 0.14
21 0.12
22 0.15
23 0.17
24 0.21
25 0.28
26 0.32
27 0.4
28 0.44
29 0.52
30 0.56
31 0.61
32 0.57
33 0.56
34 0.58
35 0.57
36 0.64
37 0.61
38 0.62
39 0.62
40 0.6
41 0.55
42 0.5
43 0.47
44 0.46
45 0.5
46 0.5
47 0.49
48 0.53
49 0.53
50 0.49
51 0.46
52 0.39
53 0.36
54 0.31
55 0.25
56 0.22
57 0.23
58 0.24
59 0.29
60 0.28
61 0.24
62 0.26
63 0.26
64 0.29
65 0.29
66 0.28
67 0.22
68 0.2
69 0.21
70 0.21
71 0.22
72 0.2
73 0.21
74 0.25
75 0.27
76 0.3
77 0.29
78 0.27
79 0.27
80 0.27
81 0.27
82 0.25
83 0.3