Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2K475

Protein Details
Accession I2K475    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
98-121EIAMIREKARRKRRRESGDNDDDFBasic
NLS Segment(s)
PositionSequence
108-116EKARRKRRR
Subcellular Location(s) nucl 17, mito_nucl 13.333, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences MPRRRQTRTSRLNDDGGVKGPSSALTSFLREQGISAESVRLRYEENVRREQEMLERGRQISAEQNXNDQEXXTNTQSAEXELPENELDSDEEVFEGDEDNEEIAMIREKARRKRRRXESGDNDDDFPNGVGAENGNNNXDGDVGKNYCLECDKEFIISVYSKKMEKYGRVGYLCPSCTKMAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.52
3 0.44
4 0.36
5 0.27
6 0.22
7 0.19
8 0.17
9 0.15
10 0.13
11 0.14
12 0.14
13 0.18
14 0.19
15 0.21
16 0.22
17 0.19
18 0.19
19 0.17
20 0.17
21 0.14
22 0.13
23 0.14
24 0.14
25 0.15
26 0.15
27 0.14
28 0.14
29 0.16
30 0.25
31 0.3
32 0.35
33 0.42
34 0.43
35 0.44
36 0.43
37 0.41
38 0.37
39 0.36
40 0.34
41 0.3
42 0.3
43 0.29
44 0.28
45 0.27
46 0.23
47 0.23
48 0.24
49 0.26
50 0.25
51 0.26
52 0.27
53 0.28
54 0.27
55 0.21
56 0.17
57 0.15
58 0.14
59 0.12
60 0.1
61 0.1
62 0.12
63 0.11
64 0.1
65 0.08
66 0.09
67 0.09
68 0.09
69 0.09
70 0.07
71 0.07
72 0.06
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.03
80 0.03
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.05
88 0.05
89 0.08
90 0.12
91 0.19
92 0.29
93 0.4
94 0.49
95 0.56
96 0.66
97 0.74
98 0.8
99 0.84
100 0.83
101 0.82
102 0.83
103 0.77
104 0.69
105 0.59
106 0.49
107 0.39
108 0.31
109 0.2
110 0.1
111 0.08
112 0.05
113 0.05
114 0.07
115 0.08
116 0.09
117 0.1
118 0.09
119 0.09
120 0.1
121 0.1
122 0.09
123 0.1
124 0.11
125 0.11
126 0.14
127 0.14
128 0.15
129 0.17
130 0.19
131 0.18
132 0.19
133 0.2
134 0.18
135 0.19
136 0.18
137 0.18
138 0.18
139 0.18
140 0.2
141 0.22
142 0.22
143 0.22
144 0.29
145 0.32
146 0.35
147 0.41
148 0.44
149 0.49
150 0.5
151 0.51
152 0.5
153 0.51
154 0.48
155 0.42
156 0.38