Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8DSF2

Protein Details
Accession A0A1B8DSF2   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
70-89STPSKPKTPKTPASRKKKLFHydrophilic
NLS Segment(s)
PositionSequence
74-87KPKTPKTPASRKKK
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
CDD cd00167  SANT  
Amino Acid Sequences MPSAWTPEADRDLLLAIIDENKLQGLDWHAIAAKMATKNNKYSFSHEGCRQHFQKLRRESASGASGSVPSTPSKPKTPKTPASRKKKLFDNSVDDEEVDQFVTPSKKRKHDAIKVDQENDVKNINDIGLGGQTAAQFKMESLSGEEEFVDLEEDLYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.1
3 0.07
4 0.08
5 0.09
6 0.08
7 0.07
8 0.08
9 0.08
10 0.07
11 0.08
12 0.1
13 0.12
14 0.12
15 0.13
16 0.13
17 0.13
18 0.13
19 0.12
20 0.13
21 0.14
22 0.18
23 0.23
24 0.26
25 0.33
26 0.37
27 0.43
28 0.41
29 0.44
30 0.48
31 0.46
32 0.49
33 0.49
34 0.53
35 0.5
36 0.55
37 0.51
38 0.51
39 0.52
40 0.52
41 0.55
42 0.54
43 0.57
44 0.52
45 0.52
46 0.46
47 0.44
48 0.41
49 0.31
50 0.24
51 0.18
52 0.15
53 0.14
54 0.13
55 0.1
56 0.08
57 0.1
58 0.13
59 0.16
60 0.23
61 0.29
62 0.32
63 0.41
64 0.48
65 0.54
66 0.6
67 0.69
68 0.71
69 0.75
70 0.82
71 0.78
72 0.76
73 0.75
74 0.72
75 0.68
76 0.64
77 0.61
78 0.55
79 0.52
80 0.47
81 0.38
82 0.33
83 0.26
84 0.2
85 0.13
86 0.08
87 0.05
88 0.08
89 0.11
90 0.13
91 0.21
92 0.28
93 0.35
94 0.39
95 0.48
96 0.56
97 0.61
98 0.7
99 0.71
100 0.75
101 0.72
102 0.71
103 0.66
104 0.57
105 0.5
106 0.42
107 0.34
108 0.23
109 0.19
110 0.17
111 0.14
112 0.11
113 0.1
114 0.09
115 0.07
116 0.07
117 0.06
118 0.07
119 0.08
120 0.09
121 0.09
122 0.09
123 0.08
124 0.09
125 0.11
126 0.1
127 0.1
128 0.12
129 0.16
130 0.15
131 0.16
132 0.16
133 0.14
134 0.14
135 0.13
136 0.11
137 0.07